RegulonDB RegulonDB 10.8: Gene Form
   

eutT gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

eutD eutT eutQ eutP eutM

Gene      
Name: eutT    Texpresso search in the literature
Synonym(s): ECK2454, G7289, b2459, ypfB
Genome position(nucleotides): 2573502 <-- 2574305 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
58.58
External database links:  
ASAP:
ABE-0008100
ECHOBASE:
EB3941
OU-MICROARRAY:
b2459
PortEco:
eutT
STRING:
511145.b2459
COLOMBOS: eutT


Product      
Name: putative ethanolamine utilization cobalamin adenosyltransferase
Synonym(s): EutT, YpfB
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 30.172
Isoelectric point: 6.44
Motif(s):
 
Type Positions Sequence
95 -> 246 THLSAEKMVAKSDPRLGFRAVLDSTIALAVWLQIELAEPWQPWLADIRSRLGNIMRADALGEPLGCQAIVGLSDEDLHRLSHQPLRYLDHDHLVPEASHGRDAALLNLLRTKVRETETVAAQVFITRSFEVLRPDILQALNRLSSTVYVMMI

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.4 - amines
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016740 - transferase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0008817 - cob(I)yrinic acid a,c-diamide adenosyltransferase activity
biological_process GO:0009236 - cobalamin biosynthetic process
GO:0006580 - ethanolamine metabolic process
GO:0046336 - ethanolamine catabolic process
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-9543N
ECOCYC:
G7289-MONOMER
ECOLIWIKI:
b2459
INTERPRO:
IPR009194
INTERPRO:
IPR036451
INTERPRO:
IPR016030
PFAM:
PF01923
PRIDE:
P65643
PRODB:
PRO_000022551
REFSEQ:
NP_416954
SMR:
P65643
UNIPROT:
P65643


Operon      
Name: eutSPQTDM         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB