RegulonDB RegulonDB 10.8: Gene Form
   

eutQ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

eutD eutT eutQ eutP eutS

Gene      
Name: eutQ    Texpresso search in the literature
Synonym(s): ECK2455, G7290, b2460, ypfC
Genome position(nucleotides): 2574302 <-- 2575003 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.98
External database links:  
ASAP:
ABE-0008102
ECHOBASE:
EB3942
OU-MICROARRAY:
b2460
PortEco:
eutQ
STRING:
511145.b2460
COLOMBOS: eutQ


Product      
Name: putative ethanolamine utilization acetate kinase EutQ
Synonym(s): EutQ, YpfC
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 25.418
Isoelectric point: 4.584
Motif(s):
 
Type Positions Sequence
85 -> 232 FTESLVAQLMEKVMKEKQSLEQGAMQPSFKSVTGKGGIKVIDGSSVKFGRFDGAEPHCVGLTDLVTGDDGSSMAAGFMQWENAFFPWTLNYDEIDMVLEGELHVRHEGQTMIAKAGDVMFIPKGSSIEFGTTSSVKFLYVAWPANWQS

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.4 - amines
Gene Ontology Terms (GO)  
molecular_function GO:0005515 - protein binding
biological_process GO:0046336 - ethanolamine catabolic process
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-9540N
ECOCYC:
G7290-MONOMER
ECOLIWIKI:
b2460
INTERPRO:
IPR014710
INTERPRO:
IPR011051
INTERPRO:
IPR010424
MODBASE:
P76555
PANTHER:
PTHR36169
PFAM:
PF06249
PRIDE:
P76555
PRODB:
PRO_000022548
REFSEQ:
NP_416955
SMR:
P76555
UNIPROT:
P76555


Operon      
Name: eutSPQTDM         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB