RegulonDB RegulonDB 10.8: Gene Form
   

tmcA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

tmcA ypfJ ypfH tmcAp5 tmcAp5

Gene      
Name: tmcA    Texpresso search in the literature
Synonym(s): ECK2470, G7297, b2474, ypfI
Genome position(nucleotides): 2593844 <-- 2595859 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.26
External database links:  
ASAP:
ABE-0008150
ECHOBASE:
EB3948
OU-MICROARRAY:
b2474
PortEco:
tmcA
STRING:
511145.b2474
COLOMBOS: tmcA


Product      
Name: tRNAMet cytidine acetyltransferase
Synonym(s): TmcA, YpfI
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 74.892
Isoelectric point: 7.658
Motif(s):
 
Type Positions Sequence
287 -> 287 T
356 -> 531 QTLWQSDPETPLKVYQLLSGAHYRTSPLDLRRMMDAPGQHFLQAAGENEIAGALWLVDEGGLSQQLSQAVWAGFRRPRGNLVAQSLAAHGNNPLAATLRGRRVSRIAVHPARQREGTGRQLIAGALQYTQDLDYLSVSFGYTGELWRFWQRCGFVLVRMGNHREASSGCYTAMALL
369 -> 483 VYQLLSGAHYRTSPLDLRRMMDAPGQHFLQAAGENEIAGALWLVDEGGLSQQLSQAVWAGFRRPRGNLVAQSLAAHGNNPLAATLRGRRVSRIAVHPARQREGTGRQLIAGALQY
296 -> 296 R
319 -> 319 R

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.3 - RNA modification
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
molecular_function GO:0016740 - transferase activity
GO:0003723 - RNA binding
GO:0008080 - N-acetyltransferase activity
GO:0016746 - transferase activity, transferring acyl groups
GO:0000049 - tRNA binding
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0051392 - tRNA N-acetyltransferase activity
biological_process GO:0008033 - tRNA processing
GO:0002101 - tRNA wobble cytosine modification
GO:0051391 - tRNA acetylation
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-12825N
ECOCYC:
G7297-MONOMER
ECOLIWIKI:
b2474
INTERPRO:
IPR016181
INTERPRO:
IPR038321
INTERPRO:
IPR033442
INTERPRO:
IPR032672
INTERPRO:
IPR027417
INTERPRO:
IPR024914
INTERPRO:
IPR013562
INTERPRO:
IPR000182
INTERPRO:
IPR007807
PANTHER:
PTHR10925:SF6
PANTHER:
PTHR10925
PDB:
2ZPA
PFAM:
PF13718
PFAM:
PF17176
PFAM:
PF08351
PFAM:
PF05127
PRIDE:
P76562
PROSITE:
PS51186
REFSEQ:
NP_416969
SMR:
P76562
UNIPROT:
P76562


Operon      
Name: ypfJ-tmcA         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter tmcAp5 2595938 reverse Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB