RegulonDB RegulonDB 10.8: Gene Form
   

hyfD gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

hyfD hyfC hyfE

Gene      
Name: hyfD    Texpresso search in the literature
Synonym(s): ECK2480, G7301, b2484
Genome position(nucleotides): 2604811 --> 2606250 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.35
Reference(s): [1] Andrews SC., et al., 1997
External database links:  
ASAP:
ABE-0008185
ECHOBASE:
EB3964
OU-MICROARRAY:
b2484
PortEco:
hyfD
STRING:
511145.b2484
COLOMBOS: hyfD


Product      
Name: hydrogenase 4 component D
Synonym(s): HyfD
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 51.755
Isoelectric point: 9.151
Motif(s):
 
Type Positions Sequence
133 -> 413 STLLGQLLFFEITGGCSWALISYYQSDKAQRSALKALLITHIGSLGLYLAAATLFLQTGTFALSAMSELHGDARYLVYGGILFAAWGKSAQLPMQAWLPDAMEAPTPISAYLHAASMVKVGVYIFARAIIDGGNIPHVIGGVGMVMALVTILYGFLMYLPQQDMKRLLAWSTITQLGWMFFGLSLSIFGSRLALEGSIAYIVNHAFAKSLFFLVAGALSYSCGTRLLPRLRGVLHTLPLPGVGFCVAALAITGVPPFNGFFSKFPLFAAGFALSVEYWILL
330 -> 350 IAYIVNHAFAKSLFFLVAGAL
69 -> 119 LFGLVIDRVSTLILFVVVFLGLLVTIYSTGYLTDKNREHPHNGTNRYYAFL
270 -> 290 VIGGVGMVMALVTILYGFLMY
390 -> 410 NGFFSKFPLFAAGFALSVEYW

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.7 - anaerobic respiration
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
GO:0044569 - [Ni-Fe] hydrogenase complex
molecular_function GO:0016491 - oxidoreductase activity
biological_process GO:0055114 - oxidation-reduction process
Note(s): Note(s): ...[more].
Reference(s): [1] Andrews SC., et al., 1997
External database links:  
ECOCYC:
MONOMER0-141
ECOLIWIKI:
b2484
INTERPRO:
IPR001750
INTERPRO:
IPR001516
PFAM:
PF00361
PFAM:
PF00662
PRIDE:
P77416
PRODB:
PRO_000022966
REFSEQ:
NP_416979
SMR:
P77416
UNIPROT:
P77416


Operon      
Name: hyfABCDEFGHIJR-focB         
Operon arrangement:
Transcription unit        Promoter
hyfABCDEFGHIJR-focB


Transcriptional Regulation      
Display Regulation             
Activated by: FhlA, CRP, HyfR
Repressed by: FNR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Andrews SC., Berks BC., McClay J., Ambler A., Quail MA., Golby P., Guest JR., 1997, A 12-cistron Escherichia coli operon (hyf) encoding a putative proton-translocating formate hydrogenlyase system., Microbiology 143 ( Pt 11):3633-47


RegulonDB