RegulonDB RegulonDB 10.6.3: Gene Form
   

hyfG gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

hyfG hyfF hyfE hyfH hyfI

Gene      
Name: hyfG    Texpresso search in the literature
Synonym(s): ECK2483, G7304, b2487
Genome position(nucleotides): 2608487 --> 2610154 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.32
Reference(s): [1] Andrews SC., et al., 1997
External database links:  
ASAP:
ABE-0008194
ECHOBASE:
EB3967
ECOCYC:
G7304
ECOLIHUB:
hyfG
OU-MICROARRAY:
b2487
REGULONDB:
b2487
STRING:
511145.b2487
M3D: hyfG
COLOMBOS: hyfG
PortEco: b2487


Product      
Name: hydrogenase 4 catalytic subunit HyfG
Synonym(s): HyfG, hydrogenase 4, large subunit
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 63.383
Isoelectric point: 6.173
Motif(s):
 
Type Positions Sequence
445 -> 523 TEGFSYKPHAFALGFVEAPRGEDVHWSMLGDNQKLFRWRCRAATYANWPVLRYMLRGNTVSDAPLIIGSLDPCYSCTDR
40 -> 155 VKINLLPDVVQYLYYQHDGWLPVLFGNDERTLNGHYAVYYALSMEGAEKCWIVVKALVDADSREFPSVTPRVPAAVWGEREIRDMYGLIPVGLPDQRRLVLPDDWPEDMHPLRKDA
220 -> 288 RGMEKLAETRMGYNEVTFLSDRVCGICGFAHSVAYTNSVENALGIEVPQRAHTIRSILLEVERLHSHLL
297 -> 448 VGFDTGFMQFFRVREKSMTMAELLIGSRKTYGLNLIGGVRRDILKEQRLQTLKLVREMRADVSELVEMLLATPNMEQRTQGIGILDRQIARDLRFDHPYADYGNIPKTLFTFTGGDVFSRVMVRVKETFDSLAMLEFALDNMPDTPLLTEGF

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.7 - anaerobic respiration
Gene Ontology Terms (GO)  
molecular_function GO:0005515 - protein binding
GO:0046872 - metal ion binding
GO:0016491 - oxidoreductase activity
GO:0016651 - oxidoreductase activity, acting on NAD(P)H
GO:0016151 - nickel cation binding
GO:0051536 - iron-sulfur cluster binding
GO:0051539 - 4 iron, 4 sulfur cluster binding
GO:0008137 - NADH dehydrogenase (ubiquinone) activity
GO:0048038 - quinone binding
GO:0051287 - NAD binding
biological_process GO:0055114 - oxidation-reduction process
Note(s): Note(s): ...[more].
Reference(s): [1] Andrews SC., et al., 1997
[2] Trchounian K. 2012
External database links:  
DIP:
DIP-9989N
ECOCYC:
MONOMER0-150
ECOLIWIKI:
b2487
INTERPRO:
IPR014029
INTERPRO:
IPR038290
INTERPRO:
IPR037232
INTERPRO:
IPR029014
INTERPRO:
IPR001501
INTERPRO:
IPR001268
INTERPRO:
IPR001135
MINT:
MINT-1310624
MODBASE:
P77329
PFAM:
PF00374
PFAM:
PF00346
PFAM:
PF00329
PRIDE:
P77329
PRODB:
PRO_000022969
PRODOM:
PD001581
PROSITE:
PS00535
PROTEINMODELPORTAL:
P77329
REFSEQ:
NP_416982
SMR:
P77329
UNIPROT:
P77329


Operon      
Name: hyfABCDEFGHIJR-focB         
Operon arrangement:
Transcription unit        Promoter
hyfABCDEFGHIJR-focB


Transcriptional Regulation      
Display Regulation             
Activated by: FhlA, CRP, HyfR
Repressed by: FNR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Andrews SC., Berks BC., McClay J., Ambler A., Quail MA., Golby P., Guest JR., 1997, A 12-cistron Escherichia coli operon (hyf) encoding a putative proton-translocating formate hydrogenlyase system., Microbiology 143 ( Pt 11):3633-47

 [2] Trchounian K., 2012, Transcriptional control of hydrogen production during mixed carbon fermentation by hydrogenases 4 (hyf) and 3 (hyc) in Escherichia coli., Gene 506(1):156-60


RegulonDB