RegulonDB RegulonDB 10.6.3: Gene Form
   

hyfH gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

hyfG hyfI hyfH hyfJ hyfF

Gene      
Name: hyfH    Texpresso search in the literature
Synonym(s): ECK2484, G7305, b2488
Genome position(nucleotides): 2610164 --> 2610709 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.95
Reference(s): [1] Andrews SC., et al., 1997
External database links:  
ASAP:
ABE-0008196
ECHOBASE:
EB3968
ECOCYC:
G7305
ECOLIHUB:
hyfH
OU-MICROARRAY:
b2488
REGULONDB:
b2488
STRING:
511145.b2488
M3D: hyfH
COLOMBOS: hyfH
PortEco: b2488


Product      
Name: hydrogenase 4 component H
Synonym(s): HyfH
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane,periplasmic space
Molecular weight: 20.159
Isoelectric point: 8.097
Motif(s):
 
Type Positions Sequence
31 -> 60 GKPDLMPSQCIACGACACACPANALTIQTD
66 -> 95 RTWQLYLGRCIYCGRCEEVCPTRAIQLTNN
39 -> 89 QCIACGACACACPANALTIQTDDQQNSRTWQLYLGRCIYCGRCEEVCPTRA

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.7 - anaerobic respiration
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0030288 - outer membrane-bounded periplasmic space
GO:0045272 - plasma membrane respiratory chain complex I
molecular_function GO:0046872 - metal ion binding
GO:0016651 - oxidoreductase activity, acting on NAD(P)H
GO:0051536 - iron-sulfur cluster binding
GO:0051539 - 4 iron, 4 sulfur cluster binding
biological_process GO:0009060 - aerobic respiration
GO:0055114 - oxidation-reduction process
Note(s): Note(s): ...[more].
Reference(s): [1] Andrews SC., et al., 1997
External database links:  
ECOCYC:
MONOMER0-144
ECOLIWIKI:
b2488
INTERPRO:
IPR017900
INTERPRO:
IPR017896
INTERPRO:
IPR010226
MODBASE:
P77423
PANTHER:
PTHR10849
PFAM:
PF12838
PRIDE:
P77423
PROSITE:
PS00198
PROSITE:
PS51379
PROTEINMODELPORTAL:
P77423
REFSEQ:
NP_416983
SMR:
P77423
UNIPROT:
P77423


Operon      
Name: hyfABCDEFGHIJR-focB         
Operon arrangement:
Transcription unit        Promoter
hyfABCDEFGHIJR-focB


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, FhlA, HyfR
Repressed by: FNR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Andrews SC., Berks BC., McClay J., Ambler A., Quail MA., Golby P., Guest JR., 1997, A 12-cistron Escherichia coli operon (hyf) encoding a putative proton-translocating formate hydrogenlyase system., Microbiology 143 ( Pt 11):3633-47


RegulonDB