RegulonDB RegulonDB 10.6.3: Gene Form
   

hyfJ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

hyfR hyfI hyfH hyfJ

Gene      
Name: hyfJ    Texpresso search in the literature
Synonym(s): ECK2486, G7307, b2490
Genome position(nucleotides): 2611457 --> 2611870 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.66
Reference(s): [1] Andrews SC., et al., 1997
External database links:  
ASAP:
ABE-0008200
ECHOBASE:
EB3970
ECOCYC:
G7307
ECOLIHUB:
hyfJ
OU-MICROARRAY:
b2490
REGULONDB:
b2490
STRING:
511145.b2490
M3D: hyfJ
COLOMBOS: hyfJ
PortEco: b2490


Product      
Name: putative hydrogenase 4 assembly protein
Synonym(s): HyfJ
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 15.577
Isoelectric point: 4.635
Motif(s):
 
Type Positions Sequence
7 -> 135 EIVFWTLRKKFVASSDEMPEHSSQVMYYSLAIGHHVGVIDCLNVAFRCPLTEYEDWLALVEEEQARRKMLGVMTFGEIVIDASHTALLTRAFAPLADDATSVWQARSIQFIHLLDEIVQEPAIYLMARK

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016491 - oxidoreductase activity
biological_process GO:0055114 - oxidation-reduction process
Note(s): Note(s): ...[more].
Evidence: [HIFS] Human inference of function from sequence
Reference(s): [1] Andrews SC., et al., 1997
External database links:  
ECOCYC:
G7307-MONOMER
ECOLIWIKI:
b2490
INTERPRO:
IPR010005
PFAM:
PF07450
PRIDE:
P77453
PRODOM:
PD021295
PROTEINMODELPORTAL:
P77453
REFSEQ:
NP_416985
UNIPROT:
P77453


Operon      
Name: hyfABCDEFGHIJR-focB         
Operon arrangement:
Transcription unit        Promoter
hyfABCDEFGHIJR-focB


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, FhlA, HyfR
Repressed by: FNR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Andrews SC., Berks BC., McClay J., Ambler A., Quail MA., Golby P., Guest JR., 1997, A 12-cistron Escherichia coli operon (hyf) encoding a putative proton-translocating formate hydrogenlyase system., Microbiology 143 ( Pt 11):3633-47


RegulonDB