RegulonDB RegulonDB 10.6.3: Gene Form
   

hyfR gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

hyfR focB hyfJ hyfI

Gene      
Name: hyfR    Texpresso search in the literature
Synonym(s): ECK2487, G7308, b2491
Genome position(nucleotides): 2611900 --> 2613912 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.61
Reference(s): [1] Andrews SC., et al., 1997
External database links:  
ASAP:
ABE-0008204
ECHOBASE:
EB3971
ECOCYC:
G7308
ECOLIHUB:
hyfR
OU-MICROARRAY:
b2491
REGULONDB:
b2491
STRING:
511145.b2491
M3D: hyfR
COLOMBOS: hyfR
PortEco: b2491


Product      
Name: DNA-binding transcriptional activator HyfR
Synonym(s): HyfR
Sequence: Get amino acid sequence Fasta Format
Regulator Family: EBP
Cellular location: cytosol
Molecular weight: 75.305
Isoelectric point: 6.237
Motif(s):
 
Type Positions Sequence
375 -> 382 GETGTGKE
169 -> 311 DLDDLIADVAREIHHFFGLASVSMVLGDHRKNEKFSLWCSDLSASHCACLPRCMPGESVLLTQTLQTRQPTLTHRADDLFLWQRDPLLLLLASNGCESALLIPLTFGNHTPGALLLAHTSSTLFSEENCQLLQHIADRIAIAV
438 -> 447 ADGGTLFLDE
207 -> 221 CSDLSASHCACLPRC
347 -> 576 IIYQSQAMEDLLQQVDIVAKSDSTVLICGETGTGKEVIARAIHQLSPRRDKPLVKINCAAIPASLLESELFGHDKGAFTGAINTHRGRFEIADGGTLFLDEIGDLPLELQPKLLRVLQEREIERLGGSRTIPVNVRVIAATNRDLWQMVEDRQFRSDLFYRLNVFPLELPPLRDRPEDIPLLAKHFTQKMARHMNRAIDAIPTEALRQLMSWDWPGNVRELENVIERAVL

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.7 - anaerobic respiration
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.2 - activator
  3 - regulation --> 3.3 - genetic unit regulated --> 3.3.1 - operon
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0008134 - transcription factor binding
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
biological_process GO:0006355 - regulation of transcription, DNA-templated
GO:0006352 - DNA-templated transcription, initiation
GO:0000160 - phosphorelay signal transduction system
GO:2000142 - regulation of DNA-templated transcription, initiation
Note(s): Note(s): ...[more].
Evidence: [IE] Inferred from experiment
Reference(s): [1] Andrews SC., et al., 1997
External database links:  
DIP:
DIP-9993N
ECOCYC:
G7308-MONOMER
ECOLIWIKI:
b2491
INTERPRO:
IPR002078
INTERPRO:
IPR025944
INTERPRO:
IPR025943
INTERPRO:
IPR025662
INTERPRO:
IPR009057
INTERPRO:
IPR029016
INTERPRO:
IPR027417
INTERPRO:
IPR003018
INTERPRO:
IPR003593
MINT:
MINT-1219276
MODBASE:
P71229
PFAM:
PF00158
PFAM:
PF01590
PRIDE:
P71229
PRODB:
PRO_000022970
PROSITE:
PS00688
PROSITE:
PS50045
PROSITE:
PS00676
PROSITE:
PS00675
PROTEINMODELPORTAL:
P71229
REFSEQ:
NP_416986
SMART:
SM00065
SMART:
SM00382
SMR:
P71229
SWISSMODEL:
P71229
UNIPROT:
P71229


Operon      
Name: hyfABCDEFGHIJR-focB         
Operon arrangement:
Transcription unit        Promoter
hyfABCDEFGHIJR-focB


Transcriptional Regulation      
Display Regulation             
Activated by: FhlA, CRP, HyfR
Repressed by: FNR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Andrews SC., Berks BC., McClay J., Ambler A., Quail MA., Golby P., Guest JR., 1997, A 12-cistron Escherichia coli operon (hyf) encoding a putative proton-translocating formate hydrogenlyase system., Microbiology 143 ( Pt 11):3633-47


RegulonDB