RegulonDB RegulonDB 10.8: Gene Form
   

bepA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

bepA yfgO yfgD TSS_2778 TSS_2778 TSS_2777 TSS_2777 TSS_2776 TSS_2776 TSS_2775 TSS_2775 bepAp1 bepAp1 bepAp2 bepAp2

Gene      
Name: bepA    Texpresso search in the literature
Synonym(s): ECK2490, G7311, b2494, yfgC
Genome position(nucleotides): 2616094 --> 2617557 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.89
External database links:  
ASAP:
ABE-0008212
ECHOBASE:
EB3951
OU-MICROARRAY:
b2494
PortEco:
yfgC
STRING:
511145.b2494
COLOMBOS: bepA


Product      
Name: β-barrel assembly-enhancing protease
Synonym(s): BepA, YfgC
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space,membrane
Molecular weight: 53.908
Isoelectric point: 7.892
Motif(s):
 
Type Positions Sequence
72 -> 259 LTQYINSLGMRLVSHANSVKTPFHFFLINNDEINAFAFFGGNVVLHSALFRYSDNESQLASVMAHEISHVTQRHLARAMEDQQRSAPLTWVGALGSILLAMASPQAGMAALTGTLAGTRQGMISFTQQNEQEADRIGIQVLQRSGFDPQAMPTFLEKLLDQARYSSRPPEILLTHPLPESRLADARNR
136 -> 140 HEISH
309 -> 342 RAAQYGRALQAMEANKYDEARKTLQPLLAAEPGN
344 -> 376 WYLDLATDIDLGQNKANEAINRLKNARDLRTNP
354 -> 418 LGQNKANEAINRLKNARDLRTNPVLQLNLANAYLQGGQPQEAANILNRYTFNNKDDSNGWDLLAQ

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.2 - degradation of macromolecules --> 1.2.3 - proteins/peptides/glycopeptides
  2 - information transfer --> 2.3 - protein related
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0030288 - outer membrane-bounded periplasmic space
GO:0042597 - periplasmic space
molecular_function GO:0003756 - protein disulfide isomerase activity
GO:0005515 - protein binding
GO:0008233 - peptidase activity
GO:0016787 - hydrolase activity
GO:0046872 - metal ion binding
GO:0008270 - zinc ion binding
GO:0004222 - metalloendopeptidase activity
GO:0008237 - metallopeptidase activity
biological_process GO:0006508 - proteolysis
GO:0051603 - proteolysis involved in cellular protein catabolic process
GO:0043165 - Gram-negative-bacterium-type cell outer membrane assembly
GO:0061077 - chaperone-mediated protein folding
Note(s): Note(s): ...[more].
Evidence: [APPHINH] Assay of protein purified to homogeneity from its native host
[IFC] Inferred by functional complementation
Reference(s): [1] Gagarinova A., et al., 2016
[2] Gerken H., et al., 2010
[3] Narita S., et al., 2013
[4] Paradis-Bleau C., et al., 2014
External database links:  
DIP:
DIP-28089N
ECOCYC:
G7311-MONOMER
ECOLIWIKI:
b2494
INTERPRO:
IPR001915
INTERPRO:
IPR030873
INTERPRO:
IPR011990
MODBASE:
P66948
PDB:
6AIT
PDB:
5XI8
PFAM:
PF01435
PRIDE:
P66948
PROSITE:
PS50005
PROSITE:
PS50293
REFSEQ:
NP_416989
SMR:
P66948
UNIPROT:
P66948


Operon      
Name: bepA-yfgD         
Operon arrangement:
Transcription unit        Promoter
bepA-yfgD
bepA-yfgD


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2775 2617541 forward nd [RS-EPT-CBR] [5]
  promoter TSS_2776 2617552 forward nd [RS-EPT-CBR] [5]
  promoter TSS_2777 2617557 forward nd [RS-EPT-CBR] [5]
  promoter TSS_2778 2617563 forward nd [RS-EPT-CBR] [5]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Gagarinova A., Stewart G., Samanfar B., Phanse S., White CA., Aoki H., Deineko V., Beloglazova N., Yakunin AF., Golshani A., Brown ED., Babu M., Emili A., 2016, Systematic Genetic Screens Reveal the Dynamic Global Functional Organization of the Bacterial Translation Machinery., Cell Rep 17(3):904-916

 [2] Gerken H., Leiser OP., Bennion D., Misra R., 2010, Involvement and necessity of the Cpx regulon in the event of aberrant beta-barrel outer membrane protein assembly., Mol Microbiol 75(4):1033-46

 [3] Narita S., Masui C., Suzuki T., Dohmae N., Akiyama Y., 2013, Protease homolog BepA (YfgC) promotes assembly and degradation of β-barrel membrane proteins in Escherichia coli., Proc Natl Acad Sci U S A 110(38):E3612-21

 [4] Paradis-Bleau C., Kritikos G., Orlova K., Typas A., Bernhardt TG., 2014, A genome-wide screen for bacterial envelope biogenesis mutants identifies a novel factor involved in cell wall precursor metabolism., PLoS Genet 10(1):e1004056

 [5] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB