RegulonDB RegulonDB 10.8: Gene Form
   

yfgJ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

der guaB xseA yfgJ CRP MarA PurR Fis Fis Fis DnaA terminator terminator TSS_2793 TSS_2793 TSS_2792 TSS_2792 xseAp xseAp guaBp guaBp TSS_2790 TSS_2790 TSS_2789 TSS_2789 TSS_2788 (cluster) TSS_2788 (cluster) TSS_2787 TSS_2787 TSS_2786 TSS_2786 TSS_2785 TSS_2785

Gene      
Name: yfgJ    Texpresso search in the literature
Synonym(s): ECK2506, G7318, b2510
Genome position(nucleotides): 2635599 <-- 2635814 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
47.69
External database links:  
ASAP:
ABE-0008266
ECHOBASE:
EB3958
OU-MICROARRAY:
b2510
PortEco:
yfgJ
STRING:
511145.b2510
COLOMBOS: yfgJ


Product      
Name: zinc ribbon domain-containing protein YfgJ
Synonym(s): YfgJ
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 7.994
Isoelectric point: 7.059
Motif(s):
 
Type Positions Sequence
4 -> 68 HCPQCQHVLDQDNGHARCRSCGEFIEMKALCPDCHQPLQVLKACGAVDYFCQHGHGLISKKRVEF

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
biological_process GO:0071978 - bacterial-type flagellum-dependent swarming motility
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G7318-MONOMER
ECOLIWIKI:
b2510
INTERPRO:
IPR010807
INTERPRO:
IPR029037
PDB:
2JNE
PFAM:
PF07191
PRIDE:
P76575
PRODOM:
PD060428
REFSEQ:
NP_417005
SMR:
P76575
UNIPROT:
P76575


Operon      
Name: yfgJ         
Operon arrangement:
Transcription unit        Promoter
 


RNA cis-regulatory element    
Attenuation: Translational


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2785 2633290 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2786 2634070 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2787 2634090 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2788 (cluster) 2634100 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_2789 2634102 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2790 2634105 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2792 2636300 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2793 2636452 reverse nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB