RegulonDB RegulonDB 10.8: Gene Form
   

bamB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

der bamB yfgM anti-anti-terminator anti-terminator terminator TSS_2797 TSS_2797 bamBp bamBp TSS_2796 (cluster) TSS_2796 (cluster) TSS_2795 (cluster) TSS_2795 (cluster) TSS_2794 TSS_2794 TSS_2793 TSS_2793 TSS_2792 TSS_2792

Gene      
Name: bamB    Texpresso search in the literature
Synonym(s): ECK2508, G7320, b2512, yfgL
Genome position(nucleotides): 2637474 <-- 2638652 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.27
External database links:  
ASAP:
ABE-0008272
ECHOBASE:
EB3960
OU-MICROARRAY:
b2512
PortEco:
bamB
STRING:
511145.b2512
COLOMBOS: bamB


Product      
Name: outer membrane protein assembly factor BamB
Synonym(s): BamB, YfgL
Sequence: Get amino acid sequence Fasta Format
Cellular location: outer membrane
Molecular weight: 41.887
Isoelectric point: 4.495
Motif(s):
 
Type Positions Sequence
78 -> 319 AGLVKALNADDGKEIWSVSLAEKDGWFSKEPALLSGGVTVSGGHVYIGSEKAQVYALNTSDGTVAWQTKVAGEALSRPVVSDGLVLIHTSNGQLQALNEADGAVKWTVNLDMPSLSLRGESAPTTAFGAAVVGGDNGRVSAVLMEQGQMIWQQRISQATGSTEIDRLSDVDTTPVVVNGVVFALAYNGNLTALDLRSGQIMWKRELGSVNDFIVDGNRIYLVDQNDRVMALTIDGGVTLWTQ
20 -> 392 CSLFNSEEDVVKMSPLPTVENQFTPTTAWSTSVGSGIGNFYSNLHPALADNVVYAADRAGLVKALNADDGKEIWSVSLAEKDGWFSKEPALLSGGVTVSGGHVYIGSEKAQVYALNTSDGTVAWQTKVAGEALSRPVVSDGLVLIHTSNGQLQALNEADGAVKWTVNLDMPSLSLRGESAPTTAFGAAVVGGDNGRVSAVLMEQGQMIWQQRISQATGSTEIDRLSDVDTTPVVVNGVVFALAYNGNLTALDLRSGQIMWKRELGSVNDFIVDGNRIYLVDQNDRVMALTIDGGVTLWTQSDLLHRLLTSPVLYNGNLVVGDSEGYLHWINVEDGRFVAQQKVDSSGFQTEPVAADGKLLIQAKDGTVYSITR
1 -> 19 MQLRKLLLPGLLSVTLLSG

 

Classification:
Multifun Terms (GenProtEC)  
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0009279 - cell outer membrane
GO:0016020 - membrane
GO:1990063 - Bam protein complex
molecular_function GO:0005515 - protein binding
GO:0042802 - identical protein binding
biological_process GO:0043165 - Gram-negative-bacterium-type cell outer membrane assembly
GO:0051205 - protein insertion into membrane
Note(s): Note(s): ...[more].
Evidence: [APPH] Assay of protein purified to homogeneity
[APPHINH] Assay of protein purified to homogeneity from its native host
[IMP] Inferred from mutant phenotype
Reference(s): [1] Hagan CL., et al., 2010
[2] Han L., et al., 2016
[3] Hart EM., et al., 2019
[4] Wu T., et al., 2005
External database links:  
DIP:
DIP-12042N
ECOCYC:
G7320-MONOMER
ECOLIWIKI:
b2512
INTERPRO:
IPR002372
INTERPRO:
IPR018391
INTERPRO:
IPR011047
INTERPRO:
IPR017687
INTERPRO:
IPR015943
PDB:
3Q7N
PDB:
3Q7O
PDB:
4XGA
PDB:
5AYW
PDB:
5D0O
PDB:
5LJO
PDB:
3Q7M
PDB:
3PRW
PDB:
3P1L
PDB:
2YMS
PDB:
2YH3
PDB:
4PK1
PFAM:
PF13360
PRIDE:
P77774
PROSITE:
PS51257
REFSEQ:
NP_417007
SMART:
SM00564
SMR:
P77774
UNIPROT:
P77774


Operon      
Name: bamB-der         
Operon arrangement:
Transcription unit        Promoter
bamB-der


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2792 2636300 reverse nd [RS-EPT-CBR] [5]
  promoter TSS_2793 2636452 reverse nd [RS-EPT-CBR] [5]
  promoter TSS_2794 2637789 reverse nd [RS-EPT-CBR] [5]
  promoter TSS_2795 (cluster) 2638676 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [5]
  promoter TSS_2796 (cluster) 2638683 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [5]
  promoter TSS_2797 2639033 reverse nd [RS-EPT-CBR] [5]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Hagan CL., Kim S., Kahne D., 2010, Reconstitution of outer membrane protein assembly from purified components., Science 328(5980):890-2

 [2] Han L., Zheng J., Wang Y., Yang X., Liu Y., Sun C., Cao B., Zhou H., Ni D., Lou J., Zhao Y., Huang Y., 2016, Structure of the BAM complex and its implications for biogenesis of outer-membrane proteins., Nat Struct Mol Biol 23(3):192-6

 [3] Hart EM., Gupta M., Wuhr M., Silhavy TJ., 2019, The Synthetic Phenotype of Δ bamB Δ bamE Double Mutants Results from a Lethal Jamming of the Bam Complex by the Lipoprotein RcsF., MBio 10(3)

 [4] Wu T., Malinverni J., Ruiz N., Kim S., Silhavy TJ., Kahne D., 2005, Identification of a multicomponent complex required for outer membrane biogenesis in Escherichia coli., Cell 121(2):235-45

 [5] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB