RegulonDB RegulonDB 10.8: Gene Form
   

yfgM gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

hisS bamB yfgM anti-anti-terminator TSS_2808 TSS_2808 TSS_2807 TSS_2807 TSS_2806 TSS_2806 TSS_2805 TSS_2805 TSS_2804 (cluster) TSS_2804 (cluster) TSS_2803 TSS_2803 TSS_2802 TSS_2802 TSS_2801 TSS_2801 TSS_2800 TSS_2800 yfgMp1 yfgMp1 yfgMp2 yfgMp2 TSS_2799 (cluster) TSS_2799 (cluster) yfgMp3 yfgMp3 TSS_2798 TSS_2798 TSS_2797 TSS_2797 bamBp bamBp TSS_2796 (cluster) TSS_2796 (cluster) TSS_2795 (cluster) TSS_2795 (cluster) TSS_2794 TSS_2794

Gene      
Name: yfgM    Texpresso search in the literature
Synonym(s): ECK2509, G7321, b2513
Genome position(nucleotides): 2638663 <-- 2639283 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.76
External database links:  
ASAP:
ABE-0008274
ECHOBASE:
EB3961
OU-MICROARRAY:
b2513
PortEco:
yfgM
STRING:
511145.b2513
COLOMBOS: yfgM


Product      
Name: ancillary SecYEG translocon subunit
Synonym(s): YfgM
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 22.176
Isoelectric point: 4.787
Motif(s):
 
Type Positions Sequence
20 -> 44 ENGKALAVGVILGVGALIGWRYWNS
2 -> 15 EIYENENDQVEAVK
15 -> 205 KRFFAENGKALAVGVILGVGALIGWRYWNSHQVDSARSASLAYQNAVTAVSEGKPDSIPAAEKFAAENKNTYGALASLELAQQFVDKNELEKAAAQLQQGLADTSDENLKAVINLRLARVQVQLKQADAALKTLDTIKGEGWAAIVADLRGEALLSKGDKQGARSAWEAGVKSDVTPALSEMMQMKINNLS
44 -> 206 SHQVDSARSASLAYQNAVTAVSEGKPDSIPAAEKFAAENKNTYGALASLELAQQFVDKNELEKAAAQLQQGLADTSDENLKAVINLRLARVQVQLKQADAALKTLDTIKGEGWAAIVADLRGEALLSKGDKQGARSAWEAGVKSDVTPALSEMMQMKINNLSI
24 -> 42 ALAVGVILGVGALIGWRYW

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0032991 - protein-containing complex
GO:0016021 - integral component of membrane
GO:0071575 - integral component of external side of plasma membrane
molecular_function GO:0005515 - protein binding
GO:0044877 - protein-containing complex binding
Note(s): Note(s): ...[more].
Evidence: [APPHINH] Assay of protein purified to homogeneity from its native host
[IGI] Inferred from genetic interaction
Reference(s): [1] Gotzke H., et al., 2015
[2] Gotzke H., et al., 2014
[3] Jauss B., et al., 2019
[4] Maddalo G., et al., 2011
External database links:  
DIP:
DIP-12043N
ECOCYC:
G7321-MONOMER
ECOLIWIKI:
b2513
INTERPRO:
IPR018704
INTERPRO:
IPR011990
INTERPRO:
IPR026039
PANTHER:
PTHR38035
PFAM:
PF09976
PRIDE:
P76576
REFSEQ:
NP_417008
SMR:
P76576
UNIPROT:
P76576


Operon      
Name: yfgM         
Operon arrangement:
Transcription unit        Promoter
yfGM
yfgM
yfgM


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2794 2637789 reverse nd [RS-EPT-CBR] [5]
  promoter TSS_2795 (cluster) 2638676 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [5]
  promoter TSS_2796 (cluster) 2638683 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [5]
  promoter TSS_2797 2639033 reverse nd [RS-EPT-CBR] [5]
  promoter TSS_2798 2639305 reverse nd [RS-EPT-CBR] [5]
  promoter TSS_2799 (cluster) 2639374 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [5]
  promoter TSS_2800 2639941 reverse nd [RS-EPT-CBR] [5]
  promoter TSS_2801 2639974 reverse nd [RS-EPT-CBR] [5]
  promoter TSS_2802 2640203 reverse nd [RS-EPT-CBR] [5]
  promoter TSS_2803 2640283 reverse nd [RS-EPT-CBR] [5]
  promoter TSS_2804 (cluster) 2640538 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [5]
  promoter TSS_2805 2640541 reverse nd [RS-EPT-CBR] [5]
  promoter TSS_2806 2640554 reverse nd [RS-EPT-CBR] [5]
  promoter TSS_2807 2640563 reverse nd [RS-EPT-CBR] [5]
  promoter TSS_2808 2640565 reverse nd [RS-EPT-CBR] [5]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Gotzke H., Muheim C., Altelaar AF., Heck AJ., Maddalo G., Daley DO., 2015, Identification of Putative Substrates for the Periplasmic Chaperone YfgM in Escherichia coli Using Quantitative Proteomics., Mol Cell Proteomics 14(1):216-26

 [2] Gotzke H., Palombo I., Muheim C., Perrody E., Genevaux P., Kudva R., Muller M., Daley DO., 2014, YfgM is an ancillary subunit of the SecYEG translocon in Escherichia coli., J Biol Chem 289(27):19089-97

 [3] Jauss B., Petriman NA., Drepper F., Franz L., Sachelaru I., Welte T., Steinberg R., Warscheid B., Koch HG., 2019, Noncompetitive binding of PpiD and YidC to the SecYEG translocon expands the global view on the SecYEG interactome in Escherichia coli., J Biol Chem 294(50):19167-19183

 [4] Maddalo G., Stenberg-Bruzell F., Gotzke H., Toddo S., Bjorkholm P., Eriksson H., Chovanec P., Genevaux P., Lehtio J., Ilag LL., Daley DO., 2011, Systematic analysis of native membrane protein complexes in Escherichia coli., J Proteome Res 10(4):1848-59

 [5] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB