RegulonDB RegulonDB 10.8: Gene Form
   

pbpC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yfhM pbpC ndk IS129 TSS_2821 (cluster) TSS_2821 (cluster) TSS_2820 TSS_2820 TSS_2819 TSS_2819 pbpCp1 pbpCp1 pbpCp2 pbpCp2 ndkp4 ndkp4 TSS_2818 TSS_2818

Gene      
Name: pbpC    Texpresso search in the literature
Synonym(s): ECK2515, G7322, b2519, yfgN
Genome position(nucleotides): 2645013 <-- 2647325 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
56.72
External database links:  
ASAP:
ABE-0008294
ECHOBASE:
EB3962
OU-MICROARRAY:
b2519
PortEco:
pbpC
STRING:
511145.b2519
COLOMBOS: pbpC


Product      
Name: peptidoglycan glycosyltransferase PbpC
Synonym(s): PBP1C, PbpC, YfgN
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane,periplasmic space
Molecular weight: 85.067
Isoelectric point: 9.911
Motif(s):
 
Type Positions Sequence
43 -> 213 RVVVAQDGTPLWRFADADGIWRYPVTIEDVSPRYLEALINYEDRWFWKHPGVNPFSVARAAWQDLTSGRVISGGSTLTMQVARLLDPHPKTFGGKIRQLWRALQLEWHLSKREILTLYLNRAPFGGTLQGIGAASWAYLGKSPANLSYSEAAMLAVLPQAPSRLRPDRWPE
62 -> 226 IWRYPVTIEDVSPRYLEALINYEDRWFWKHPGVNPFSVARAAWQDLTSGRVISGGSTLTMQVARLLDPHPKTFGGKIRQLWRALQLEWHLSKREILTLYLNRAPFGGTLQGIGAASWAYLGKSPANLSYSEAAMLAVLPQAPSRLRPDRWPERAEAARNKVLERM
312 -> 519 RVRGWVGSVDLNDDSRFGHVDMVNSIRSPGSVLKPFVYGLALDEGLIHPASLLQDVPRRTGDYRPGNFDSGFHGPISMSEALVRSLNLPAVQVLEAYGPKRFAAKLRNVGLPLYLPNGAAPNLSLILGGAGAKLEDMAAAYTAFARHGKAGKLRLQPDDPLLERPLMSSGAAWIIRRIMADEAQPLPDSALPRVAPLAWKTGTSYGYR
278 -> 559 AGLQRRLEELAQNWKGRLPPRSSLAMIVVDHTDMRVRGWVGSVDLNDDSRFGHVDMVNSIRSPGSVLKPFVYGLALDEGLIHPASLLQDVPRRTGDYRPGNFDSGFHGPISMSEALVRSLNLPAVQVLEAYGPKRFAAKLRNVGLPLYLPNGAAPNLSLILGGAGAKLEDMAAAYTAFARHGKAGKLRLQPDDPLLERPLMSSGAAWIIRRIMADEAQPLPDSALPRVAPLAWKTGTSYGYRDAWAIGVNARYVIGIWTGRPDGTPVVGQFGFASAVPLLNQ
9 -> 29 GCWITLAAAPFLLFLAAWGAD

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.7 - murein (peptidoglycan)
  6 - cell structure --> 6.2 - murein
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0030288 - outer membrane-bounded periplasmic space
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0003824 - catalytic activity
GO:0005515 - protein binding
GO:0016757 - transferase activity, transferring glycosyl groups
GO:0008233 - peptidase activity
GO:0016787 - hydrolase activity
GO:0016740 - transferase activity
GO:0004180 - carboxypeptidase activity
GO:0008955 - peptidoglycan glycosyltransferase activity
GO:0008144 - drug binding
GO:0008658 - penicillin binding
biological_process GO:0008152 - metabolic process
GO:0006508 - proteolysis
GO:0009252 - peptidoglycan biosynthetic process
GO:0046677 - response to antibiotic
GO:0008360 - regulation of cell shape
GO:0071555 - cell wall organization
GO:0051781 - positive regulation of cell division
Note(s): Note(s): ...[more].
Reference(s): [1] Denome SA., et al., 1999
[2] Derouaux A., et al., 2008
[3] Massova I., et al., 1998
[4] Serres MH., et al., 2005
[5] von Rechenberg M., et al., 2005
External database links:  
CAZY:
GT51
DIP:
DIP-10442N
ECOCYC:
G7322-MONOMER
ECOLIWIKI:
b2519
INTERPRO:
IPR036950
INTERPRO:
IPR023346
INTERPRO:
IPR012338
INTERPRO:
IPR011815
INTERPRO:
IPR001264
INTERPRO:
IPR001460
INTERPRO:
IPR009647
MINT:
MINT-1308552
MODBASE:
P76577
PFAM:
PF00905
PFAM:
PF06832
PFAM:
PF00912
PRIDE:
P76577
PRODB:
PRO_000023496
REFSEQ:
NP_417014
SMR:
P76577
UNIPROT:
P76577


Operon      
Name: yfhM-pbpC         
Operon arrangement:
Transcription unit        Promoter
yfhM-pbpC


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2818 2644913 reverse nd [RS-EPT-CBR] [6]
  promoter ndkp4 2644960 reverse Similarity to the consensus
Read more >
[ICWHO] [7]
  promoter pbpCp2 2647368 reverse Similarity to the consensus
Read more >
[ICWHO] [7]
  promoter pbpCp1 2647493 reverse Similarity to the consensus
Read more >
[ICWHO] [7]
  promoter TSS_2819 2647653 reverse nd [RS-EPT-CBR] [6]
  promoter TSS_2820 2651918 reverse nd [RS-EPT-CBR] [6]
  promoter TSS_2821 (cluster) 2651928 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [6]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Denome SA., Elf PK., Henderson TA., Nelson DE., Young KD., 1999, Escherichia coli mutants lacking all possible combinations of eight penicillin binding proteins: viability, characteristics, and implications for peptidoglycan synthesis., J Bacteriol 181(13):3981-93

 [2] Derouaux A., Wolf B., Fraipont C., Breukink E., Nguyen-Disteche M., Terrak M., 2008, The monofunctional glycosyltransferase of Escherichia coli localizes to the cell division site and interacts with penicillin-binding protein 3, FtsW, and FtsN., J Bacteriol 190(5):1831-4

 [3] Massova I., Mobashery S., 1998, Kinship and diversification of bacterial penicillin-binding proteins and beta-lactamases., Antimicrob Agents Chemother 42(1):1-17

 [4] Serres MH., Riley M., 2005, Gene fusions and gene duplications: relevance to genomic annotation and functional analysis., BMC Genomics 6(1):33

 [5] von Rechenberg M., Blake BK., Ho YS., Zhen Y., Chepanoske CL., Richardson BE., Xu N., Kery V., 2005, Ampicillin/penicillin-binding protein interactions as a model drug-target system to optimize affinity pull-down and mass spectrometric strategies for target and pathway identification., Proteomics 5(7):1764-73

 [6] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [7] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB