RegulonDB RegulonDB 10.8: Gene Form
   

yfhM gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yfhM pbpC sseA IS129 TSS_2822 (cluster) TSS_2822 (cluster) sseAp sseAp yfhMp yfhMp TSS_2821 (cluster) TSS_2821 (cluster) TSS_2820 TSS_2820 TSS_2819 TSS_2819 pbpCp1 pbpCp1 pbpCp2 pbpCp2

Gene      
Name: yfhM    Texpresso search in the literature
Synonym(s): ECK2516, G7323, b2520
Genome position(nucleotides): 2647326 <-- 2652287 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.96
External database links:  
ASAP:
ABE-0008296
ECHOBASE:
EB3175
OU-MICROARRAY:
b2520
PortEco:
yfhM
STRING:
511145.b2520
COLOMBOS: yfhM


Product      
Name: α2-macroglobulin
Synonym(s): ECAM, YfhM
Sequence: Get amino acid sequence Fasta Format
Cellular location: extracellular space,inner membrane
Molecular weight: 181.584
Isoelectric point: 5.041
Motif(s):
 
Type Positions Sequence
57 -> 164 KLAQQSAGKVLTLLDLSEVQLDGAATLVLTFSIPLDPDQDFSRVIHVVDKKSGKVDGAWELSDNLKELRLRHLEPKRDLIVTIGKEVKALNNATFSKDYEKTITTRDI
165 -> 289 QPSVGFASRGSLLPGKVVEGLPVMALNVNNVDVNFFRVKPESLPAFISQWEYRNSLANWQSDKLLQMADLVYTGRFDLNPARNTREKLLLPLGDIKPLQQAGVYLAVMNQAGRYDYSNPATLFTL
388 -> 479 FFMFGPRDLYRPGETVILNGLLRDADGKALPNQPIKLDVIKPDGQVLRSVVSQPENGLYHFTWPLDSNAATGMWHIRANTGDNQYRMWDFHV
854 -> 934 DENRRLDLALETPAKMRPNQPLTVKIKASTKNGEKPKQVNVLVSAVDSGVLNITDYVTPDPWQAFFGQKRYGADIYDIYGQ
18 -> 1653 CDNNDNAPTAVKKDAPSEVTKAASSENASSAKLSVPERQKLAQQSAGKVLTLLDLSEVQLDGAATLVLTFSIPLDPDQDFSRVIHVVDKKSGKVDGAWELSDNLKELRLRHLEPKRDLIVTIGKEVKALNNATFSKDYEKTITTRDIQPSVGFASRGSLLPGKVVEGLPVMALNVNNVDVNFFRVKPESLPAFISQWEYRNSLANWQSDKLLQMADLVYTGRFDLNPARNTREKLLLPLGDIKPLQQAGVYLAVMNQAGRYDYSNPATLFTLSDIGVSAHRYHNRLDIFTQSLENGAAQQGIEVSLLNEKGQTLTQATSDAQGHVQLENDKNAALLLARKDGQTTLLDLKLPALDLAEFNIAGAPGYSKQFFMFGPRDLYRPGETVILNGLLRDADGKALPNQPIKLDVIKPDGQVLRSVVSQPENGLYHFTWPLDSNAATGMWHIRANTGDNQYRMWDFHVEDFMPERMALNLTGEKTPLTPKDEVKFSVVGYYLYGAPANGNTLQGQLFLRPLREAVSALPGFEFGDIAAENLSRTLDEVQLTLDDKGRGEVSTESQWKETHSPLQVIFQGSLLESGGRPVTRRAEQAIWPADALPGIRPQFASKSVYDYRTDSTVKQPIVDEGSNAAFDIVYSDAQGVKKAVSGLQVRLIRERRDYYWNWSEDEGWQSQFDQKDLIENEQTLDLKADETGKVSFPVEWGAYRLEVKAPNEAVSSVRFWAGYSWQDNSDGSGAVRPDRVTLKLDKASYRPGDTIKLHIAAPTAGKGYAMVESSEGPLWWQEIDVRAQGLDLTIPVDKTWNRHDLYLSTLVVRPGDKSRSATPKRAVGVLHLPLGDENRRLDLALETPAKMRPNQPLTVKIKASTKNGEKPKQVNVLVSAVDSGVLNITDYVTPDPWQAFFGQKRYGADIYDIYGQVIEGQGRLAALRFGGDGDELKRGGKPPVNHVNIVVQQALPVTLNEQGEGSVTLPIGDFNGELRVMAQAWTADDFGSNESKVIVAAPVIAELNMPRFMASGDTSRLTLDITNLTDKPQKLNVALTASGLLELVSDSPAAVELAPGVRTTLFIPVRALPGYGDGEIQATISGLALPGETVADQHKQWKIGVRPAFPAQTVNYGTALQPGETWAIPADGLQNFSPVTLEGQLLLSGKPPLNIARYIKELKAYPYGCLEQTASGLFPSLYTNAAQLQALGIKGDSDEKRRASVDIGISRLLQMQRDNGGFALWDKNGDEEYWLTAYVMDFLVRAGEQGYSVPTDAINRGNERLLRYLQDPGMMSIPYADNLKASKFAVQSYAALVLARQQKAPLGALREIWEHRADAASGLPLLQLGVALKTMGDATRGEEAIALALKTPRNSDERIWLGDYGSSLRDNALMLSLLEENKLLPDEQYTLLNTLSQQAFGERWLSTQESNALFLAARTIQDLPGKWQAQTSFSAEQLTGEKAQNSNLNSDQLVTLQVSNSGDQPLWLRMDASGYPQSAPLPANNVLQIERHILGTDGKSKSLDSLRSGDLVLVWLQVKASNSVPDALVVDLLPAGLELENQNLANGSASLEQSGGEVQNLLNQMQQASIKHIEFRDDRFVAAVAVDEYQPVTLVYLARAVTPGTYQVPQPMVESMYVPQWRATGAAEDLLIVRP

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.6 - protection
Gene Ontology Terms (GO)  
cellular_component GO:0005615 - extracellular space
GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0031362 - anchored component of external side of plasma membrane
molecular_function GO:0004866 - endopeptidase inhibitor activity
GO:0030414 - peptidase inhibitor activity
GO:0042803 - protein homodimerization activity
biological_process GO:0010466 - negative regulation of peptidase activity
GO:0010951 - negative regulation of endopeptidase activity
Note(s): Note(s): ...[more].
Evidence: [APPHINH] Assay of protein purified to homogeneity from its native host
[HIFS] Human inference of function from sequence
[IMP] Inferred from mutant phenotype
Reference(s): [1] Budd A., et al., 2004
[2] Doan N., et al., 2008
[3] Garcia-Ferrer I., et al., 2015
External database links:  
DIP:
DIP-28064N
ECOCYC:
G7323-MONOMER
ECOLIWIKI:
b2520
INTERPRO:
IPR041246
INTERPRO:
IPR026284
INTERPRO:
IPR040639
INTERPRO:
IPR041203
INTERPRO:
IPR021868
INTERPRO:
IPR011626
INTERPRO:
IPR011625
INTERPRO:
IPR008930
INTERPRO:
IPR002890
INTERPRO:
IPR001599
INTERPRO:
IPR041462
MODBASE:
P76578
PANTHER:
PTHR11412:SF124
PDB:
5A42
PDB:
4ZJH
PDB:
4ZJG
PDB:
4ZIU
PDB:
4ZIQ
PDB:
4RTD
PFAM:
PF17970
PFAM:
PF17972
PFAM:
PF11974
PFAM:
PF17973
PFAM:
PF17962
PFAM:
PF00207
PFAM:
PF01835
PFAM:
PF07678
PFAM:
PF07703
PRIDE:
P76578
PROSITE:
PS51257
REFSEQ:
NP_417015
SMART:
SM01360
SMART:
SM01359
SMR:
P76578
UNIPROT:
P76578


Operon      
Name: yfhM-pbpC         
Operon arrangement:
Transcription unit        Promoter
yfhM-pbpC


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter pbpCp2 2647368 reverse Similarity to the consensus
Read more >
[ICWHO] [4]
  promoter pbpCp1 2647493 reverse Similarity to the consensus
Read more >
[ICWHO] [4]
  promoter TSS_2819 2647653 reverse nd [RS-EPT-CBR] [5]
  promoter TSS_2820 2651918 reverse nd [RS-EPT-CBR] [5]
  promoter TSS_2821 (cluster) 2651928 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [5]
  promoter TSS_2822 (cluster) 2652468 forward For this promoter, there
Read more >
[RS-EPT-CBR] [5]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Budd A., Blandin S., Levashina EA., Gibson TJ., 2004, Bacterial alpha2-macroglobulins: colonization factors acquired by horizontal gene transfer from the metazoan genome?, Genome Biol 5(6):R38

 [2] Doan N., Gettins PG., 2008, alpha-Macroglobulins are present in some gram-negative bacteria: characterization of the alpha2-macroglobulin from Escherichia coli., J Biol Chem 283(42):28747-56

 [3] Garcia-Ferrer I., Arede P., Gomez-Blanco J., Luque D., Duquerroy S., Caston JR., Goulas T., Gomis-Ruth FX., 2015, Structural and functional insights into Escherichia coli α2-macroglobulin endopeptidase snap-trap inhibition., Proc Natl Acad Sci U S A 112(27):8290-5

 [4] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [5] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB