RegulonDB RegulonDB 10.8: Gene Form
   

csiE gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

csiE hcaT hcaR yfhR iroK CRP terminator hcaTp7 hcaTp7 hcaTp6 hcaTp6 hcaTp1 hcaTp1 csiEp csiEp

Gene      
Name: csiE    Texpresso search in the literature
Synonym(s): ECK2532, G7329, b2535, csi-16
Genome position(nucleotides): 2665435 --> 2666715 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.52
Reference(s): [1] Marschall C., et al., 1995
External database links:  
ASAP:
ABE-0008346
ECHOBASE:
EB3194
OU-MICROARRAY:
b2535
PortEco:
csiE
STRING:
511145.b2535
COLOMBOS: csiE


Shine dalgarno      
Sequence: tatgcttatgGGAGATctacagATG


Product      
Name: stationary phase inducible protein CsiE
Synonym(s): CsiE
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 49.04
Isoelectric point: 7.819
Motif(s):
 
Type Positions Sequence
342 -> 342 I
131 -> 216 ALVNLCSRRLQKRFESRDIHFLCLYLQYCLLQHHAGITPQFNPLQRRWAESCLEFQVAQEIGRHWQRRALQPVPPDEPLFMALLFS
229 -> 336 QRDRQLRQSIKRLVNHFRELGNVRFYDEQGLCDQLYTHLAQALNRSLFAIGIDNTLPEEFARLYPRLVRTTRAALAGFESEYGVHLSDEESGLVAVIFGAWLMQENDL
240 -> 328 RLVNHFRELGNVRFYDEQGLCDQLYTHLAQALNRSLFAIGIDNTLPEEFARLYPRLVRTTRAALAGFESEYGVHLSDEESGLVAVIFGA
120 -> 225 ARNFYDDTNLQALVNLCSRRLQKRFESRDIHFLCLYLQYCLLQHHAGITPQFNPLQRRWAESCLEFQVAQEIGRHWQRRALQPVPPDEPLFMALLFSMLRVPDPLR

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
biological_process GO:0006355 - regulation of transcription, DNA-templated
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-9332N
ECOCYC:
G7329-MONOMER
ECOLIWIKI:
b2535
INTERPRO:
IPR036634
INTERPRO:
IPR011608
MODBASE:
P54901
PFAM:
PF00874
PRIDE:
P54901
PROSITE:
PS51372
REFSEQ:
NP_417030
SMR:
P54901
UNIPROT:
P54901


Operon      
Name: csiE         
Operon arrangement:
Transcription unit        Promoter
csiE


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, H-NS


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter hcaTp1 2667863 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter hcaTp6 2667928 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter hcaTp7 2668053 reverse Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Marschall C., Hengge-Aronis R., 1995, Regulatory characteristics and promoter analysis of csiE, a stationary phase-inducible gene under the control of sigma S and the cAMP-CRP complex in Escherichia coli., Mol Microbiol 18(1):175-84

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB