RegulonDB RegulonDB 10.7: Gene Form
   

hcaC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

hcaE hcaD hcaB hcaF hcaC

Gene      
Name: hcaC    Texpresso search in the literature
Synonym(s): ECK2537, G7334, b2540, hcaa3, phdB, yfhW
Genome position(nucleotides): 2670908 --> 2671228 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.45
External database links:  
ASAP:
ABE-0008359
ECHOBASE:
EB3231
OU-MICROARRAY:
b2540
PORTECO:
hcaC
REGULONDB:
b2540
STRING:
511145.b2540
M3D: hcaC
COLOMBOS: hcaC
PortEco: b2540


Product      
Name: putative 3-phenylpropionate/cinnamate dioxygenase ferredoxin subunit
Synonym(s): 3-phenylpropionate dioxygenase, predicted ferredoxin subunit, HcaC, PhdB, YfhW
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 11.329
Isoelectric point: 4.024
Motif(s):
 
Type Positions Sequence
4 -> 99 IYACPVADVPEGEALRIDTSPVIALFNVGGEFYAINDRCSHGNASMSEGYLEDDATVECPLHAASFCLKTGKALCLPATDPLTTYPVHVEGGDIFI

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
Gene Ontology Terms (GO)  
molecular_function GO:0046872 - metal ion binding
GO:0016491 - oxidoreductase activity
GO:0051536 - iron-sulfur cluster binding
GO:0051537 - 2 iron, 2 sulfur cluster binding
GO:0008695 - 3-phenylpropionate dioxygenase activity
biological_process GO:0019439 - aromatic compound catabolic process
GO:0055114 - oxidation-reduction process
GO:0019380 - 3-phenylpropionate catabolic process
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
HCAC-MONOMER
ECOLIWIKI:
b2540
INTERPRO:
IPR017941
INTERPRO:
IPR023739
INTERPRO:
IPR036922
MODBASE:
P0ABW0
PFAM:
PF00355
PRIDE:
P0ABW0
PRODB:
PRO_000022859
PROSITE:
PS51296
PROTEINMODELPORTAL:
P0ABW0
REFSEQ:
NP_417035
SMR:
P0ABW0
SWISSMODEL:
P0ABW0
UNIPROT:
P0ABW0


Operon      
Name: hcaEFCBD         
Operon arrangement:
Transcription unit        Promoter
hcaEFCBD


Transcriptional Regulation      
Display Regulation             
Activated by: HcaR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB