RegulonDB RegulonDB 10.7: Gene Form
   

hcaB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

hcaD hcaB hcaF hcaC hcaE

Gene      
Name: hcaB    Texpresso search in the literature
Synonym(s): ECK2538, G7335, b2541, phdD, yfhX
Genome position(nucleotides): 2671225 --> 2672037 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
56.09
External database links:  
ASAP:
ABE-0008361
ECHOBASE:
EB3232
OU-MICROARRAY:
b2541
PORTECO:
hcaB
REGULONDB:
b2541
STRING:
511145.b2541
M3D: hcaB
COLOMBOS: hcaB
PortEco: b2541


Product      
Name: 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase
Synonym(s): HcaB, PhdD, YfhX
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 28.5
Isoelectric point: 6.237
Motif(s):
 
Type Positions Sequence
9 -> 194 IFITGGGSGLGLALVERFIEEGAQVATLELSAAKVASLRQRFGEHILAVEGNVTCYADYQRAVDQILTRSGKLDCFIGNAGIWDHNASLVNTPAETLETGFHELFNVNVLGYLLGAKACAPALIASEGSMIFTLSNAAWYPGGGGPLYTASKHAATGLIRQLAYELAPKVRVNGVGPCGMASDLRG
10 -> 34 FITGGGSGLGLALVERFIEEGAQVA

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016491 - oxidoreductase activity
GO:0018498 - 2,3-dihydroxy-2,3-dihydro-phenylpropionate dehydrogenase activity
biological_process GO:0019439 - aromatic compound catabolic process
GO:0055114 - oxidation-reduction process
GO:0019380 - 3-phenylpropionate catabolic process
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-9863N
ECOCYC:
PHENPRODIOLDEHYDROG-MONOMER
ECOLIWIKI:
b2541
INTERPRO:
IPR036291
INTERPRO:
IPR020904
INTERPRO:
IPR002347
INTERPRO:
IPR023643
MINT:
MINT-1239788
MODBASE:
P77646
PANTHER:
PTHR24322
PFAM:
PF00106
PRIDE:
P0CI31
PRINTS:
PR00080
PRINTS:
PR00081
PRODB:
PRO_000022858
PROSITE:
PS00061
PROTEINMODELPORTAL:
P0CI31
REFSEQ:
NP_417036
SMR:
P0CI31
SWISSMODEL:
P77646
UNIPROT:
P0CI31


Operon      
Name: hcaEFCBD         
Operon arrangement:
Transcription unit        Promoter
hcaEFCBD


Transcriptional Regulation      
Display Regulation             
Activated by: HcaR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB