RegulonDB RegulonDB 10.7: Gene Form
   

yphA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

hcaD yphB yphA TSS_2835 TSS_2835

Gene      
Name: yphA    Texpresso search in the literature
Synonym(s): ECK2540, G7337, b2543
Genome position(nucleotides): 2673346 --> 2673768 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.65
External database links:  
ASAP:
ABE-0008365
ECHOBASE:
EB3235
OU-MICROARRAY:
b2543
PORTECO:
yphA
REGULONDB:
b2543
STRING:
511145.b2543
M3D: yphA
COLOMBOS: yphA
PortEco: b2543


Product      
Name: putative inner membrane protein
Synonym(s): YphA
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 15.211
Isoelectric point: 9.604
Motif(s):
 
Type Positions Sequence
57 -> 77 AAIIAVVMEVPAAILIVLGFF
80 -> 100 PLAVLFIFYTLGTAVIGHHYW
14 -> 34 PVLLLIARIAVVLIFIIFGFP
16 -> 97 LLLIARIAVVLIFIIFGFPKMMGFDGTVQYMASLGAPMPMLAAIIAVVMEVPAAILIVLGFFTRPLAVLFIFYTLGTAVIGH
117 -> 137 NVSIAGAFLLLAITGPGAISL

 

Classification:
Multifun Terms (GenProtEC)  
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G7337-MONOMER
ECOLIWIKI:
b2543
INTERPRO:
IPR032808
PFAM:
PF07681
PRIDE:
P0AD47
PROTEINMODELPORTAL:
P0AD47
REFSEQ:
NP_417038
UNIPROT:
P0AD47


Operon      
Name: yphA         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2835 2673321 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB