RegulonDB RegulonDB 10.8: Gene Form
   

yfhL gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yfhH yfhL ryfB shoB

Gene      
Name: yfhL    Texpresso search in the literature
Synonym(s): ECK2560, G7346, b2562
Genome position(nucleotides): 2699663 --> 2699923 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
44.83
External database links:  
ASAP:
ABE-0008431
ECHOBASE:
EB3006
OU-MICROARRAY:
b2562
PortEco:
yfhL
STRING:
511145.b2562
COLOMBOS: yfhL


Product      
Name: putative 4Fe-4S cluster-containing protein YfhL
Synonym(s): YfhL
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 9.791
Isoelectric point: 4.635
Motif(s):
 
Type Positions Sequence
6 -> 25 TKKCINCDMCEPECPNEAIS
31 -> 65 YEINSDKCTECVGHYETPTCQKVCPIPNTIVKDPA
1 -> 29 MALLITKKCINCDMCEPECPNEAISMGDH

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.5 - tRNA
  3 - regulation --> 3.1 - type of regulation --> 3.1.3 - posttranscriptional --> 3.1.3.2 - covalent modification, demodification, maturation
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0046872 - metal ion binding
GO:0051536 - iron-sulfur cluster binding
GO:0051539 - 4 iron, 4 sulfur cluster binding
biological_process GO:0055114 - oxidation-reduction process
GO:0002097 - tRNA wobble base modification
Note(s): Note(s): ...[more].
Reference(s): [1] Lauhon CT. 2019
External database links:  
ECOCYC:
G7346-MONOMER
ECOLIWIKI:
b2562
INTERPRO:
IPR017900
INTERPRO:
IPR017896
MODBASE:
P52102
PDB:
2ZVS
PFAM:
PF00037
PRIDE:
P52102
PROSITE:
PS00198
PROSITE:
PS51379
REFSEQ:
NP_417057
SMR:
P52102
SWISSMODEL:
P52102
UNIPROT:
P52102


Operon      
Name: yfhL         
Operon arrangement:
Transcription unit        Promoter
yfhL


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Lauhon CT., 2019, Identification and characterization of genes required for 5-hydroxyuridine synthesis in Bacillus subtilis and Escherichia coli tRNA., J Bacteriol


RegulonDB