RegulonDB RegulonDB 10.8: Gene Form
   

rseB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

lepA rseB rseA rpoE rseC rseD DksA DksA-ppGpp DksA-ppGpp ppGpp anti-terminator terminator terminator TSS_2871 TSS_2871 TSS_2870 TSS_2870 rseAp3 rseAp3 TSS_2869 TSS_2869 TSS_2868 (cluster) TSS_2868 (cluster) TSS_2867 TSS_2867 lepAp lepAp TSS_2866 TSS_2866 lepBp1 lepBp1

Gene      
Name: rseB    Texpresso search in the literature
Synonym(s): ECK2569, G7348, b2571
Genome position(nucleotides): 2707798 <-- 2708754 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.78
External database links:  
ASAP:
ABE-0008459
ECHOBASE:
EB2969
OU-MICROARRAY:
b2571
PortEco:
rseB
STRING:
511145.b2571
COLOMBOS: rseB


Product      
Name: anti-sigma factor stabilizing protein RseB
Synonym(s): RseB
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space
Molecular weight: 35.75
Isoelectric point: 8.858
Motif(s):
 
Type Positions Sequence
217 -> 313 KAKFSWTPTWLPQGFSEVSSSRRPLPTMDNMPIESRLYSDGLFSFSVNVNRATPSSTDQMLRTGRRTVSTSVRDNAEITIVGELPPQTAKRIAENIK
222 -> 318 WTPTWLPQGFSEVSSSRRPLPTMDNMPIESRLYSDGLFSFSVNVNRATPSSTDQMLRTGRRTVSTSVRDNAEITIVGELPPQTAKRIAENIKFGAAQ
24 -> 318 TPASGALLQQMNLASQSLNYELSFISINKQGVESLRYRHARLDNRPLAQLLQMDGPRREVVQRGNEISYFEPGLEPFTLNGDYIVDSLPSLIYTDFKRLSPYYDFISVGRTRIADRLCEVIRVVARDGTRYSYIVWMDTESKLPMRVDLLDRDGETLEQFRVIAFNVNQDISSSMQTLAKANLPPLLSVPVGEKAKFSWTPTWLPQGFSEVSSSRRPLPTMDNMPIESRLYSDGLFSFSVNVNRATPSSTDQMLRTGRRTVSTSVRDNAEITIVGELPPQTAKRIAENIKFGAAQ
1 -> 23 MKQLWFAMSLVTGSLLFSANASA
28 -> 197 GALLQQMNLASQSLNYELSFISINKQGVESLRYRHARLDNRPLAQLLQMDGPRREVVQRGNEISYFEPGLEPFTLNGDYIVDSLPSLIYTDFKRLSPYYDFISVGRTRIADRLCEVIRVVARDGTRYSYIVWMDTESKLPMRVDLLDRDGETLEQFRVIAFNVNQDISSS

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.1 - sigma factors, anti-sigmafactors
  5 - cell processes --> 5.5 - adaptations --> 5.5.3 - starvation
  5 - cell processes --> 5.5 - adaptations --> 5.5.6 - other (mechanical, nutritional, oxidative stress)
Gene Ontology Terms (GO)  
cellular_component GO:0030288 - outer membrane-bounded periplasmic space
GO:0042597 - periplasmic space
molecular_function GO:0005515 - protein binding
GO:0008289 - lipid binding
GO:0042802 - identical protein binding
GO:0045152 - antisigma factor binding
biological_process GO:0050821 - protein stabilization
GO:0032885 - regulation of polysaccharide biosynthetic process
External database links:  
DIP:
DIP-10802N
ECOCYC:
G7348-MONOMER
ECOLIWIKI:
b2571
INTERPRO:
IPR038484
INTERPRO:
IPR033436
INTERPRO:
IPR033434
INTERPRO:
IPR005588
PANTHER:
PTHR38782
PDB:
3M4W
PDB:
2V43
PDB:
2V42
PDB:
2P4B
PFAM:
PF17188
PFAM:
PF03888
PRIDE:
P0AFX9
PRODB:
PRO_000023878
REFSEQ:
NP_417066
SMR:
P0AFX9
UNIPROT:
P0AFX9


Operon      
Name: rseD-rpoE-rseABC         
Operon arrangement:
Transcription unit        Promoter
rseABC
rpoE-rseABC
rpoE-rseABC
rpoE-rseABC
rpoE-rseABC
rpoE-rseABC
rpoE-rseABC


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, NtrC, GlrR, RcsB
Repressed by: CpxR, IHF


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter lepBp1 2705464 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_2866 2706051 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_2867 2707204 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_2868 (cluster) 2707211 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_2869 2709043 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_2870 2709761 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_2871 2709854 reverse nd [RS-EPT-CBR] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB