RegulonDB RegulonDB 10.8: Gene Form
   

patZ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

patZ tapT pssL pssA CRP CRP pssAp pssAp TSS_2895 (cluster) TSS_2895 (cluster) pssAp4 pssAp4 TSS_2894 TSS_2894 TSS_2893 TSS_2893 pkap pkap

Gene      
Name: patZ    Texpresso search in the literature
Synonym(s): ECK2582, G7350, b2584, pka, yfiQ
Genome position(nucleotides): 2719953 --> 2722613 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.3
External database links:  
ASAP:
ABE-0008506
ECHOBASE:
EB3976
OU-MICROARRAY:
b2584
PortEco:
yfiQ
STRING:
511145.b2584
COLOMBOS: patZ


Product      
Name: peptidyl-lysine N-acetyltransferase
Synonym(s): PatZ, Pka, YfiQ
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 97.987
Isoelectric point: 6.376
Motif(s):
 
Type Positions Sequence
487 -> 523 QPILQAYGMNTLPTWIASDSTEAVHIAEQIGYPVALK
506 -> 507 ST
472 -> 694 QAIAEGATSLDTHEVQPILQAYGMNTLPTWIASDSTEAVHIAEQIGYPVALKLRSPDIPHKSEVQGVMLYLRTANEVQQAANAIFDRVKMAWPQARVHGLLVQSMANRAGAQELRVVVEHDPVFGPLIMLGEGGVEWRPEDQAVVALPPLNMNLARYLVIQGIKSKKIRARSALRPLDVAGLSQLLVQVSNLIVDCPEIQRLDIHPLLASGSEFTALDVTLDI
13 -> 129 KSIAVIGASMKPNRAGYLMMRNLLAGGFNGPVLPVTPAWKAVLGVLAWPDIASLPFTPDLAVLCTNASRNLALLEELGEKGCKTCIILSAPASQHEDLRACALRHNMRLLGPNSLGL
726 -> 881 CLFRPILPEDEPQLQQFISRVTKEDLYYRYFSEINEFTHEDLANMTQIDYDREMAFVAVRRIDQTEEILGVTRAISDPDNIDAEFAVLVRSDLKGLGLGRRLMEKLITYTRDHGLQRLNGITMPNNRGMVALARKLGFNVDIQLEEGIVGLTLNLA

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.3 - protein related --> 2.3.3 - posttranslational modification
  3 - regulation --> 3.1 - type of regulation --> 3.1.3 - posttranscriptional --> 3.1.3.2 - covalent modification, demodification, maturation
Gene Ontology Terms (GO)  
cellular_component GO:0005886 - plasma membrane
GO:0032991 - protein-containing complex
molecular_function GO:0005515 - protein binding
GO:0016740 - transferase activity
GO:0046872 - metal ion binding
GO:0008080 - N-acetyltransferase activity
GO:0016746 - transferase activity, transferring acyl groups
GO:0005524 - ATP binding
GO:0048037 - cofactor binding
GO:0042802 - identical protein binding
GO:0052858 - peptidyl-lysine acetyltransferase activity
GO:0061733 - peptide-lysine-N-acetyltransferase activity
biological_process GO:0006979 - response to oxidative stress
GO:0009408 - response to heat
GO:0018393 - internal peptidyl-lysine acetylation
External database links:  
DIP:
DIP-12068N
ECOCYC:
G7350-MONOMER
ECOLIWIKI:
b2584
INTERPRO:
IPR003781
INTERPRO:
IPR036291
INTERPRO:
IPR032875
INTERPRO:
IPR016181
INTERPRO:
IPR016102
INTERPRO:
IPR000182
INTERPRO:
IPR011761
INTERPRO:
IPR013815
MINT:
MINT-1243710
MODBASE:
P76594
PFAM:
PF00583
PFAM:
PF13380
PFAM:
PF13607
PRIDE:
P76594
PROSITE:
PS50975
PROSITE:
PS51186
REFSEQ:
NP_417079
SMART:
SM00881
SMR:
P76594
UNIPROT:
P76594


Operon      
Name: tapT-patZ         
Operon arrangement:
Transcription unit        Promoter
pka
 


Transcriptional Regulation      
Display Regulation             
Activated by: CRP


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2893 2722287 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2894 2722503 forward nd [RS-EPT-CBR] [1]
  promoter pssAp4 2722578 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_2895 (cluster) 2722625 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB