RegulonDB RegulonDB 10.7: Gene Form
   

yfjF gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

smpB ratA bamE yfjF anti-anti-terminator anti-terminator terminator smpBp5 smpBp5 TSS_2970 TSS_2970

Gene      
Name: yfjF    Texpresso search in the literature
Synonym(s): ECK2614, G7357, b2618, ratB
Genome position(nucleotides): 2754008 <-- 2754298 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.86
External database links:  
ASAP:
ABE-0008616
ECHOBASE:
EB2984
OU-MICROARRAY:
b2618
PORTECO:
yfjF
REGULONDB:
b2618
STRING:
511145.b2618
M3D: yfjF
COLOMBOS: yfjF
PortEco: b2618


Product      
Name: putative component of the Rsx system
Synonym(s): RatB, YfjF
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 10.789
Isoelectric point: 9.472
Motif(s):
 
Type Positions Sequence
5 -> 87 IAVEVAYALPEKQYLQRVTLQEGATVEEAIRASGLLELRTDIDLTKNKVGIYSRPAKLSDSVHDGDRVEIYRPLIADPKELRR

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
Note(s): Note(s): ...[more].
Reference(s): [1] Zhang Y., et al., 2011
External database links:  
ECOCYC:
G7357-MONOMER
ECOLIWIKI:
b2618
INTERPRO:
IPR005346
INTERPRO:
IPR016155
INTERPRO:
IPR037021
PANTHER:
PTHR37483
PFAM:
PF03658
PRIDE:
P52119
PROTEINMODELPORTAL:
P52119
REFSEQ:
NP_417108
SMR:
P52119
UNIPROT:
P52119


Operon      
Name: ratA-yfjF         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2970 2753605 forward nd [RS-EPT-CBR] [2]
  promoter smpBp5 2754767 forward Similarity to the consensus
Read more >
[ICWHO] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Zhang Y., Inouye M., 2011, RatA (YfjG), an Escherichia coli toxin, inhibits 70S ribosome association to block translation initiation., Mol Microbiol 79(6):1418-29

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [3] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB