RegulonDB RegulonDB 10.7: Gene Form
   

yfjJ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

abpB yfjI yfjJ abpA TSS_2973 TSS_2973 yfjJp6 yfjJp6

Gene      
Name: yfjJ    Texpresso search in the literature
Synonym(s): ECK2622, G7361, b2626
Genome position(nucleotides): 2760547 --> 2761173 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
40.35
External database links:  
ASAP:
ABE-0008646
ECHOBASE:
EB2988
OU-MICROARRAY:
b2626
PORTECO:
yfjJ
REGULONDB:
b2626
STRING:
511145.b2626
M3D: yfjJ
COLOMBOS: yfjJ
PortEco: b2626


Product      
Name: CP4-57 prophage; protein YfjJ
Synonym(s): YfjJ
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 24.561
Isoelectric point: 9.633
Motif(s):
 
Type Positions Sequence
17 -> 206 RIKQVIDDSLNEHLNSMILRVDLHDPIDTENMDNPFFQPRVDSGAISRFTSALKAKLKHDKHIKTQRKDWPDSRHSTLRYAWVREYTKNRKRHYHLILCFNQDAYYHLGDYDLNRNTLRTMITTAWYSALGIPIDSSGKLVNYPPNGKYLLNRKRDNFEQTYSDLMNRVDYMTKVRTKIVGDGDRNFGCS

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.1 - prophage genes and phage related functions
Gene Ontology Terms (GO)  
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G7361-MONOMER
ECOLIWIKI:
b2626
INTERPRO:
IPR021723
PFAM:
PF11726
PRIDE:
P52125
PROTEINMODELPORTAL:
P52125
REFSEQ:
NP_417115
UNIPROT:
P52125


Operon      
Name: yfjJ         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yfjJp6 2760507 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_2973 2761243 forward nd [RS-EPT-CBR] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB