RegulonDB RegulonDB 10.8: Gene Form
   

abpB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

abpB abpA yfjJ yfjM TSS_2975 TSS_2975 TSS_2974 TSS_2974 TSS_2973 TSS_2973

Gene      
Name: abpB    Texpresso search in the literature
Synonym(s): ECK2623, G7362, b2627, yfjK
Genome position(nucleotides): 2761351 <-- 2763540 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
48.9
External database links:  
ASAP:
ABE-0008648
ECHOBASE:
EB2989
OU-MICROARRAY:
b2627
PortEco:
yfjK
STRING:
511145.b2627
COLOMBOS: abpB


Product      
Name: CP4-57 prophage; putative helicase YfjK
Synonym(s): AbpB, CP4-57 prophage; anti-bacteriophage protein; mutations lead to radiation resistance, YfjK
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 83.062
Isoelectric point: 6.415
Motif(s):
 
Type Positions Sequence
109 -> 271 FDLLKSGQNVVLSAPTSMGKSAIVDSLLGMGTLKRLVLVVPTVALADETRRRLQERFGDRYQIIHHSSQVCHSDQAVYVLTQERVNERDDIVDIDLFVIDEFYKLAFRQLKSGDIDHQDERVIELNIALSKLLKVSRQFYLTGPFVNSIRGLEKLGYPHTFVS
297 -> 472 ALGEIAHACVDATIIYCKSPTVAGLVARELIRLGHGTPTENPHVDWVSEEFDADWDYTVALRNGIGLHFGALPRALQQYTADQFNAGKLRFLLCTSTIIEGVNTIAKNVVIYDNRDGTRSIDKFTHGNIKGRAGRMGVHFVGKIFCLEEIPEDNLNQEVDIPLGIQGIDTPINLLA
364 -> 433 HFGALPRALQQYTADQFNAGKLRFLLCTSTIIEGVNTIAKNVVIYDNRDGTRSIDKFTHGNIKGRAGRMG

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.1 - prophage genes and phage related functions
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
biological_process GO:0051607 - defense response to virus
GO:0010212 - response to ionizing radiation
Note(s): Note(s): ...[more].
Evidence: [IMP] Inferred from mutant phenotype
Reference(s): [1] Harris DR., et al., 2009
[2] Sandler SJ. 2014
[3] Yasui R., et al., 2014
External database links:  
DIP:
DIP-12076N
ECOCYC:
G7362-MONOMER
ECOLIWIKI:
b2627
INTERPRO:
IPR014001
INTERPRO:
IPR001650
INTERPRO:
IPR027417
MINT:
MINT-1230544
MODBASE:
P52126
PFAM:
PF00271
PRIDE:
P52126
PROSITE:
PS51192
PROSITE:
PS51194
REFSEQ:
NP_417116
SMART:
SM00487
SMART:
SM00490
SMR:
P52126
UNIPROT:
P52126


Operon      
Name: abpAB         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2973 2761243 forward nd [RS-EPT-CBR] [4]
  promoter TSS_2974 2765321 reverse nd [RS-EPT-CBR] [4]
  promoter TSS_2975 2765482 reverse nd [RS-EPT-CBR] [4]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Harris DR., Pollock SV., Wood EA., Goiffon RJ., Klingele AJ., Cabot EL., Schackwitz W., Martin J., Eggington J., Durfee TJ., Middle CM., Norton JE., Popelars MC., Li H., Klugman SA., Hamilton LL., Bane LB., Pennacchio LA., Albert TJ., Perna NT., Cox MM., Battista JR., 2009, Directed evolution of ionizing radiation resistance in Escherichia coli., J Bacteriol 191(16):5240-52

 [2] Sandler SJ., 2014, Vive la resistance!, Elife 3:e02387

 [3] Yasui R., Washizaki A., Furihata Y., Yonesaki T., Otsuka Y., 2014, AbpA and AbpB provide anti-phage activity in Escherichia coli., Genes Genet Syst 89(2):51-60

 [4] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB