RegulonDB RegulonDB 10.8: Gene Form
   

yfjM gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

abpA rnlA yfjM rnlB abpB IscR rnlBp2 rnlBp2 TSS_2980 TSS_2980 rnlBp rnlBp yfjMp3 yfjMp3 rnlAp rnlAp TSS_2978 TSS_2978 TSS_2977 TSS_2977 rnlAp2 rnlAp2 TSS_2975 TSS_2975 TSS_2974 TSS_2974

Gene      
Name: yfjM    Texpresso search in the literature
Synonym(s): ECK2625, G7364, b2629
Genome position(nucleotides): 2765513 <-- 2765776 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
45.45
External database links:  
ASAP:
ABE-0008654
ECHOBASE:
EB2991
OU-MICROARRAY:
b2629
PortEco:
yfjM
STRING:
511145.b2629
COLOMBOS: yfjM


Product      
Name: CP4-57 prophage; protein YfjM
Synonym(s): YfjM
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 9.967
Isoelectric point: 6.971
Motif(s):
 
Type Positions Sequence
5 -> 56 VHRFGNLFLISPSSNSILSNYSPADKKKFYVETERAESPKQAIMMSYKEWGP

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.1 - prophage genes and phage related functions
Gene Ontology Terms (GO)  
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G7364-MONOMER
ECOLIWIKI:
b2629
INTERPRO:
IPR011089
PFAM:
PF07510
PRIDE:
P52128
REFSEQ:
NP_417118
UNIPROT:
P52128


Operon      
Name: yfjM         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2974 2765321 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2975 2765482 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2977 2765896 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2978 2765900 forward nd [RS-EPT-CBR] [1]
  promoter yfjMp3 2765985 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_2980 2766837 reverse nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB