RegulonDB RegulonDB 10.8: Gene Form
   

yfjS gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yfjR yfjT yfjS ypjK

Gene      
Name: yfjS    Texpresso search in the literature
Synonym(s): ECK2632, G7371, b2636
Genome position(nucleotides): 2770681 --> 2771124 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.9
External database links:  
ASAP:
ABE-0008680
ECHOBASE:
EB2997
OU-MICROARRAY:
b2636
PortEco:
yfjS
STRING:
511145.b2636
COLOMBOS: yfjS


Product      
Name: CP4-57 prophage; inner membrane lipoprotein YfjS
Synonym(s): YfjS
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 16.735
Isoelectric point: 4.609
Motif(s):
 
Type Positions Sequence
21 -> 147 CDDRSDDLKAISKFKDLTPPRFSDVVSRQDDVSEEWSQVGFSSGLTLQVLRTRESPDGCEGGSYYYLVDMEEKTVQPLMNALCIADNIKLEYHEVTDPYTKEKYFEYSHDGKLMGRLLIPSNPDNRE
136 -> 136 R
1 -> 20 MKRKTLPLLALVATSLFLSA
60 -> 61 GF

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G7371-MONOMER
ECOLIWIKI:
b2636
PRIDE:
O52982
PROSITE:
PS51257
REFSEQ:
NP_417124
SMR:
O52982
UNIPROT:
O52982


Operon      
Name: yfjR-ypjK-yfjST         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB