RegulonDB RegulonDB 10.8: Gene Form
   

yfjT gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yfjT yfjS yfjU TSS_2982 TSS_2982

Gene      
Name: yfjT    Texpresso search in the literature
Synonym(s): ECK2633, G7372, b2637
Genome position(nucleotides): 2771148 --> 2771615 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.28
External database links:  
ASAP:
ABE-0008683
ECHOBASE:
EB2998
OU-MICROARRAY:
b2637
PortEco:
yfjT
STRING:
511145.b2637
COLOMBOS: yfjT


Product      
Name: CP4-57 prophage; uncharacterized protein YfjT
Synonym(s): YfjT
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 17.099
Isoelectric point: 6.781
Motif(s):
 
Type Positions Sequence
1 -> 23 MKIRSLSRFVLASTMFASFTASA
65 -> 65 H
29 -> 29 Q
24 -> 155 VPGLWQQGYGQGNAEYSVTDASGKMFTINCTGNPDQNGIYQHSVFLILAGDKTVSSHDDSTGITVVMDHKQYAIPSTLGWRNGDNAWFSFIMDIRKARQFDVYVNDQKVGSFNPDVRNAQKVLPTLADCTND
26 -> 26 G

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.1 - prophage genes and phage related functions
Gene Ontology Terms (GO)  
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G7372-MONOMER
ECOLIWIKI:
b2637
PRIDE:
P52135
REFSEQ:
NP_417125
UNIPROT:
P52135


Operon      
Name: yfjR-ypjK-yfjST         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2982 2771808 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB