RegulonDB RegulonDB 10.8: Gene Form
   

yfjY gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yfjY yfjX ypjJ

Gene      
Name: yfjY    Texpresso search in the literature
Synonym(s): ECK2640, G7379, b2644
Genome position(nucleotides): 2776386 --> 2776868 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.24
External database links:  
ASAP:
ABE-0008706
ECHOBASE:
EB3003
ECOO157CYC:
Z1657
OU-MICROARRAY:
b2644
PortEco:
yfjY
STRING:
511145.b2644
COLOMBOS: yfjY


Product      
Name: CP4-57 prophage; RadC-like JAB domain-containing protein YfjY
Synonym(s): YfjY
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 17.964
Isoelectric point: 9.004
Motif(s):
 
Type Positions Sequence
40 -> 159 TSTQAARDWLKLKMAGLEREEFMMLYLNQQNQLIAHETLFAGSISSTEVHPREVVKRALYFNAAAVILAHNHPSGDTTPSQADKTITQRLVQALQLVDIRVPDHLIVGGRQIYSFAEHGL
109 -> 122 HNHPSGDTTPSQAD
38 -> 160 AFTSTQAARDWLKLKMAGLEREEFMMLYLNQQNQLIAHETLFAGSISSTEVHPREVVKRALYFNAAAVILAHNHPSGDTTPSQADKTITQRLVQALQLVDIRVPDHLIVGGRQIYSFAEHGLL

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.1 - prophage genes and phage related functions
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0008233 - peptidase activity
GO:0016787 - hydrolase activity
GO:0046872 - metal ion binding
GO:0008237 - metallopeptidase activity
biological_process GO:0006508 - proteolysis
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G7379-MONOMER
ECOLIWIKI:
b2644
ECOO157CYC:
Z1657-MONOMER
INTERPRO:
IPR025657
INTERPRO:
IPR037518
INTERPRO:
IPR020891
INTERPRO:
IPR001405
PANTHER:
PTHR30471
PFAM:
PF04002
PRIDE:
P52140
PROSITE:
PS50249
PROSITE:
PS01302
REFSEQ:
NP_417131
SMR:
P52140
UNIPROT:
P52140


Operon      
Name: yfjXY-ypjJ-yfjZ-ypjF         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB