RegulonDB RegulonDB 10.8: Gene Form
   

ypjF gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ypjA ypjF yfjZ psaA TSS_2985 TSS_2985 TSS_2984 TSS_2984 TSS_2983 TSS_2983

Gene      
Name: ypjF    Texpresso search in the literature
Synonym(s): ECK2643, G7381, b2646
Genome position(nucleotides): 2777453 --> 2777782 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
47.58
External database links:  
ASAP:
ABE-0008711
ECHOBASE:
EB4032
ECOO157CYC:
Z3165
OU-MICROARRAY:
b2646
PortEco:
ypjF
STRING:
511145.b2646
COLOMBOS: ypjF


Product      
Name: CP4-57 prophage; toxin of the YpjF-YfjZ toxin-antitoxin system
Synonym(s): YpjF
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 12.308
Isoelectric point: 7.614
Motif(s):
 
Type Positions Sequence
65 -> 65 F
1 -> 108 MNTLPATISQAAKPCLSPVAVWQMLLTRLLEQHYGLTLNDTPFSDETVIKEHIDAGITLADAVNFLVEKYELVRIDHRGFSWQQQSPYISVVDILRARRSTGLLKTNV

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.6 - protection --> 5.6.3 - cell killing
  8 - extrachromosomal --> 8.1 - prophage genes and phage related functions
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G7381-MONOMER
ECOLIWIKI:
b2646
ECOO157CYC:
Z3165-MONOMER
INTERPRO:
IPR009610
PFAM:
PF06755
PRIDE:
Q46953
REFSEQ:
NP_417133
UNIPROT:
Q46953


Operon      
Name: yfjXY-ypjJ-yfjZ-ypjF         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2983 2777835 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2984 2778839 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2985 2779236 reverse nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB