RegulonDB RegulonDB 10.8: Gene Form
   

ypjB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ypjA ypjB ypjC pinH ypjBp ypjBp ypjAp8 ypjAp8 TSS_2985 TSS_2985 TSS_2984 TSS_2984

Gene      
Name: ypjB    Texpresso search in the literature
Synonym(s): ECK2646, G7384, b2649
Genome position(nucleotides): 2783638 <-- 2784429 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
35.1
External database links:  
ASAP:
ABE-0008724
ECHOBASE:
EB3291
OU-MICROARRAY:
b2649
PortEco:
ypjB
STRING:
316407.85675507
COLOMBOS: ypjB


Product      
Name: DUF5508 domain-containing protein YpjB
Synonym(s): YpjB
Sequence: Get amino acid sequence Fasta Format
Cellular location: outer membrane
Molecular weight: 29.787
Isoelectric point: 4.393
Motif(s):
 
Type Positions Sequence
1 -> 263 MESRNSYENKIDEISSLSESKEHPIDIQEKKDAFVNEFKGVLFDKNTRSSELLFNFYECCYKFLPRAQPQDKIDSYNSALQAFSIFCSSTLTHNNIGFDFKLFPEVKLSGEHLETVFKYKNGDDVREIAKINITLQKEEGGLYNLRGLDFKGCFFSGQNFSNYDIQYVNWGTSLFDVDTPCIFNAPAYNKSNEKSLKPVSENGLSGVLTDRNNKIKLITGVAPFDDILFMDDDFDDSSSEDDPVENSPVVTSPVVSSSKSSFQ

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0009279 - cell outer membrane
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G7384-MONOMER
ECOLIWIKI:
b2649
INTERPRO:
IPR035124
PFAM:
PF17621
PRIDE:
P76612
PRODOM:
PD114157
REFSEQ:
NP_417136
UNIPROT:
P76612


Operon      
Name: ypjB         
Operon arrangement:
Transcription unit        Promoter
ypjB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2984 2778839 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2985 2779236 reverse nd [RS-EPT-CBR] [1]
  promoter ypjAp8 2782822 reverse Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB