RegulonDB RegulonDB 10.6.3: Gene Form
   

glaH gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ygaQ lhgD glaH unknown ileY Nac GlaR GlaR CRP ppGpp anti-anti-terminator anti-terminator terminator gabDp1 gabDp1 gabDp2 gabDp2 csiDp csiDp

Gene      
Name: glaH    Texpresso search in the literature
Synonym(s): ECK2653, G7394, b2659, csi-12, csiD, ygaT
Genome position(nucleotides): 2788985 --> 2789962 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.29
Reference(s): [1] Marschall C., et al., 1998
External database links:  
ASAP:
ABE-0008754
ECHOBASE:
EB3295
ECOCYC:
G7394
ECOLIHUB:
csiD
OU-MICROARRAY:
b2659
REGULONDB:
b2659
STRING:
511145.b2659
M3D: glaH
COLOMBOS: glaH
PortEco: b2659


Product      
Name: glutarate hydroxylase GlaH
Synonym(s): CsiD, GlaH, PF08943 family protein CsiD, YgaT
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 37.36
Isoelectric point: 6.135
Motif(s):
 
Type Positions Sequence
212 -> 213 MR
152 -> 153 QP
310 -> 311 QR
21 -> 314 FTLTPSAQSPRLLELTFTEQTTKQFLEQVAEWPVQALEYKSFLRFRVAKILDDLCANQLQPLLLKTLLNRAEGALLINAVGVDDVKQADEMVKLATAVAHLIGRSNFDAMSGQYYARFVVKNVDNSDSYLRQPHRVMELHNDGTYVEEITDYVLMMKIDEQNMQGGNSLLLHLDDWEHLDNYFRHPLARRPMRFAAPPSKNVSKDVFHPVFDVDQQGRPVMRYIDQFVQPKDFEEGVWLSELSDAIETSKGILSVPVPVGKFLLINNLFWLHGRDRFTPHPDLRRELMRQRGYF

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.3 - amino acids
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0050498 - oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, with 2-oxoglutarate as one donor, and the other dehydrogenated
GO:0046872 - metal ion binding
GO:0005506 - iron ion binding
GO:0008198 - ferrous iron binding
GO:0016709 - oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen
GO:0042802 - identical protein binding
biological_process GO:0055114 - oxidation-reduction process
GO:0051289 - protein homotetramerization
GO:0019477 - L-lysine catabolic process
GO:0090549 - response to carbon starvation
External database links:  
ECOCYC:
G7394-MONOMER
ECOLIWIKI:
b2659
INTERPRO:
IPR015038
MODBASE:
P76621
PDB:
1JR7
PFAM:
PF08943
PRIDE:
P76621
PRODB:
PRO_000022337
PRODOM:
PD135861
PROTEINMODELPORTAL:
P76621
REFSEQ:
NP_417145
SMR:
P76621
UNIPROT:
P76621


Operon      
Name: glaH-lhgD-gabDTP         
Operon arrangement:
Transcription unit        Promoter
csiD-ygaF-gabDTP
gabDTP
gabDTP


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, H-NS, Lrp
Repressed by: GlaR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Marschall C., Labrousse V., Kreimer M., Weichart D., Kolb A., Hengge-Aronis R., 1998, Molecular analysis of the regulation of csiD, a carbon starvation-inducible gene in Escherichia coli that is exclusively dependent on sigma s and requires activation by cAMP-CRP., J Mol Biol 276(2):339-53


RegulonDB