RegulonDB RegulonDB 10.9: Gene Form
   

kbp gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

Gene      
Name: kbp    Texpresso search in the literature
Synonym(s): ECK2659, G7395, b2665, ygaU, yzzM
Genome position(nucleotides): 2796337 <-- 2796786 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
48.44
External database links:  
ASAP:
ABE-0008767
ECHOBASE:
EB2540
ECOLIHUB:
ygaU
OU-MICROARRAY:
b2665
STRING:
511145.b2665
COLOMBOS: kbp


Product      
Name: K+ binding protein
Synonym(s): Kbp, YgaU, YzzM
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 16.063
Isoelectric point: 5.779
Motif(s):
 
Type Positions Sequence
24 -> 89 KDDQAKKVQEHLNKTGIPDADKVNIQIADGKATVTGDGLSQEAKEKILVAVGNISGIASVDDQVKT
99 -> 147 YTVKSGDTLSAISKQVYGNANLYNKIFEANKPMLKSPDKIYPGQVLRIP
97 -> 146 QFYTVKSGDTLSAISKQVYGNANLYNKIFEANKPMLKSPDKIYPGQVLRI
23 -> 91 DKDDQAKKVQEHLNKTGIPDADKVNIQIADGKATVTGDGLSQEAKEKILVAVGNISGIASVDDQVKTAT
2 -> 149 GLFNFVKDAGEKLWDAVTGQHDKDDQAKKVQEHLNKTGIPDADKVNIQIADGKATVTGDGLSQEAKEKILVAVGNISGIASVDDQVKTATPATASQFYTVKSGDTLSAISKQVYGNANLYNKIFEANKPMLKSPDKIYPGQVLRIPEE

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.5 - adaptations --> 5.5.1 - osmotic pressure
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
molecular_function GO:0030955 - potassium ion binding
biological_process GO:0035864 - response to potassium ion
Note(s): Note(s): ...[more].
Evidence: [IDA] Inferred from direct assay
Reference(s): [1] Ashraf KU., et al., 2016
External database links:  
DIP:
DIP-48134N
ECOCYC:
G7395-MONOMER
ECOLIWIKI:
b2665
INTERPRO:
IPR036779
INTERPRO:
IPR007055
INTERPRO:
IPR014004
INTERPRO:
IPR018392
PDB:
5FIM
PFAM:
PF04972
PFAM:
PF01476
PRIDE:
P0ADE6
PROSITE:
PS50914
PROSITE:
PS51782
REFSEQ:
NP_417151
SMART:
SM00749
SMART:
SM00257
SMR:
P0ADE6
UNIPROT:
P0ADE6


Operon      
Name: yqaE-kbp         
Operon arrangement:
Transcription unit        Promoter
kbp
yqaE
yqaE-kbp


Transcriptional Regulation      
Display Regulation             
Activated by: CpxR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2987 2796813 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_2988 2796815 reverse nd [RS-EPT-CBR] [2]



RegulonDB