RegulonDB RegulonDB 10.8: Gene Form
   

yqaE gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

kbp ygaV yqaE CpxR CyaR TSS_2990 TSS_2990 TSS_2989 TSS_2989 yqaEp yqaEp TSS_2988 TSS_2988 kbpp4 kbpp4 TSS_2987 TSS_2987

Gene      
Name: yqaE    Texpresso search in the literature
Synonym(s): ECK2660, G7396, b2666
Genome position(nucleotides): 2796870 <-- 2797028 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.94
External database links:  
ASAP:
ABE-0008770
ECHOBASE:
EB4060
OU-MICROARRAY:
b2666
PortEco:
yqaE
STRING:
511145.b2666
COLOMBOS: yqaE


Product      
Name: Pmp3 family protein YqaE
Synonym(s): YqaE
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 5.865
Isoelectric point: 10.452
Motif(s):
 
Type Positions Sequence
1 -> 21 MGFWRIVITIILPPLGVLLGK
23 -> 43 FGWAFIINILLTLLGYIPGLI
3 -> 48 FWRIVITIILPPLGVLLGKGFGWAFIINILLTLLGYIPGLIHAFWV

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
biological_process GO:0046677 - response to antibiotic
Note(s): Note(s): ...[more].
Reference(s): [1] Vogt SL., et al., 2014
External database links:  
ECOCYC:
G7396-MONOMER
ECOLIWIKI:
b2666
INTERPRO:
IPR000612
PANTHER:
PTHR21659
PFAM:
PF01679
PRIDE:
P0AE42
PROSITE:
PS01309
REFSEQ:
NP_417152
UNIPROT:
P0AE42


Operon      
Name: yqaE-kbp         
Operon arrangement:
Transcription unit        Promoter
kbp
yqaE
yqaE-kbp


Transcriptional Regulation      
Display Regulation             
Activated by: CpxR


Regulation by small RNA    
  Display Regulation
small RNA cyaR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2987 2796813 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_2988 2796815 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_2989 2797187 forward nd [RS-EPT-CBR] [2]
  promoter TSS_2990 2797266 forward nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Vogt SL., Evans AD., Guest RL., Raivio TL., 2014, The Cpx envelope stress response regulates and is regulated by small noncoding RNAs., J Bacteriol 196(24):4229-38

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB