RegulonDB RegulonDB 10.9: Gene Form
   

yqaE gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

Gene      
Name: yqaE    Texpresso search in the literature
Synonym(s): ECK2660, G7396, b2666
Genome position(nucleotides): 2796870 <-- 2797028 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.94
External database links:  
ASAP:
ABE-0008770
ECHOBASE:
EB4060
ECOLIHUB:
yqaE
OU-MICROARRAY:
b2666
STRING:
511145.b2666
COLOMBOS: yqaE


Product      
Name: Pmp3 family protein YqaE
Synonym(s): YqaE
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 5.865
Isoelectric point: 10.452
Motif(s):
 
Type Positions Sequence
1 -> 21 MGFWRIVITIILPPLGVLLGK
23 -> 43 FGWAFIINILLTLLGYIPGLI
3 -> 48 FWRIVITIILPPLGVLLGKGFGWAFIINILLTLLGYIPGLIHAFWV

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
biological_process GO:0046677 - response to antibiotic
Note(s): Note(s): ...[more].
Reference(s): [1] Vogt SL., et al., 2014
External database links:  
ECOCYC:
G7396-MONOMER
ECOLIWIKI:
b2666
INTERPRO:
IPR000612
PANTHER:
PTHR21659
PFAM:
PF01679
PRIDE:
P0AE42
PROSITE:
PS01309
REFSEQ:
NP_417152
UNIPROT:
P0AE42


Operon      
Name: yqaE-kbp         
Operon arrangement:
Transcription unit        Promoter
kbp
yqaE
yqaE-kbp


Transcriptional Regulation      
Display Regulation             
Activated by: CpxR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2987 2796813 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_2988 2796815 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_2989 2797187 forward nd [RS-EPT-CBR] [2]
  promoter TSS_2990 2797266 forward nd [RS-EPT-CBR] [2]



RegulonDB