RegulonDB RegulonDB 10.8: Gene Form
   

ygaV gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ygaP ygaV yqaE CpxR CyaR TSS_2990 TSS_2990 TSS_2989 TSS_2989 yqaEp yqaEp

Gene      
Name: ygaV    Texpresso search in the literature
Synonym(s): ECK2661, G7397, b2667
Genome position(nucleotides): 2797211 --> 2797510 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.0
External database links:  
ASAP:
ABE-0008784
ECHOBASE:
EB3296
OU-MICROARRAY:
b2667
PortEco:
ygaV
STRING:
511145.b2667
COLOMBOS: ygaV


Product      
Name: putative DNA-binding transcriptional regulator YgaV
Synonym(s): YgaV
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 10.596
Isoelectric point: 8.756
Motif(s):
 
Type Positions Sequence
23 -> 70 HPKRLLILCMLSGSPGTSAGELTRITGLSASATSQHLARMRDEGLIDS
41 -> 60 AGELTRITGLSASATSQHLA
7 -> 99 LQASAEQAAALLKAMSHPKRLLILCMLSGSPGTSAGELTRITGLSASATSQHLARMRDEGLIDSQRDAQRILYSIKNEAVNAIIATLKNVYCP

 

Classification:
Multifun Terms (GenProtEC)  
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0003700 - DNA-binding transcription factor activity
GO:0044212 - transcription regulatory region DNA binding
biological_process GO:0006355 - regulation of transcription, DNA-templated
Note(s): Note(s): ...[more].
Evidence: [AIFS] Automated inference of function from sequence
[IMP] Inferred from mutant phenotype
Reference(s): [1] Gueune H., et al., 2008
[2] Perez-Rueda E., et al., 2004
External database links:  
ECOCYC:
G7397-MONOMER
ECOLIWIKI:
b2667
INTERPRO:
IPR036390
INTERPRO:
IPR001845
INTERPRO:
IPR036388
INTERPRO:
IPR011991
MODBASE:
P77295
PDB:
3CUO
PFAM:
PF01022
PRIDE:
P77295
PRINTS:
PR00778
PROSITE:
PS50987
REFSEQ:
NP_417153
SMART:
SM00418
SMR:
P77295
UNIPROT:
P77295


Operon      
Name: ygaVP         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2989 2797187 forward nd [RS-EPT-CBR] [3]
  promoter TSS_2990 2797266 forward nd [RS-EPT-CBR] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Gueune H., Durand MJ., Thouand G., DuBow MS., 2008, The ygaVP genes of Escherichia coli form a tributyltin-inducible operon., Appl Environ Microbiol 74(6):1954-8

 [2] Perez-Rueda E., Collado-Vides J., Segovia L., 2004, Phylogenetic distribution of DNA-binding transcription factors in bacteria and archaea., Comput Biol Chem 28(5-6):341-50

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB