RegulonDB RegulonDB 10.8: Gene Form
   

ygaM gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ygaC ygaM nrdH nrdI NrdR NrdR Fur terminator anti-terminator anti-anti-terminator nrdHp nrdHp ygaCp ygaCp ygaMp ygaMp

Gene      
Name: ygaM    Texpresso search in the literature
Synonym(s): ECK2666, G7400, b2672
Genome position(nucleotides): 2800146 --> 2800475 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.94
External database links:  
ASAP:
ABE-0008799
ECHOBASE:
EB3070
OU-MICROARRAY:
b2672
PortEco:
ygaM
STRING:
511145.b2672
COLOMBOS: ygaM


Product      
Name: DUF883 domain-containing protein YgaM
Synonym(s): YgaM
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane,cytosol
Molecular weight: 11.847
Isoelectric point: 8.799
Motif(s):
 
Type Positions Sequence
16 -> 107 DIQNDVNQLADSLESVLKSWGSDAKGEAEAARSKAQALLKETRARMHGRTRVQQAARDAVGCADSFVRERPWCSVGTAAAVGIFIGALLSMR
87 -> 106 WCSVGTAAAVGIFIGALLSM

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0043022 - ribosome binding
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-48124N
ECOCYC:
B0899-MONOMER
ECOLIWIKI:
b2672
INTERPRO:
IPR010279
MINT:
MINT-1287856
PANTHER:
PTHR35893
PFAM:
PF05957
PRIDE:
P0ADQ7
REFSEQ:
NP_417158
UNIPROT:
P0ADQ7


Operon      
Name: ygaM         
Operon arrangement:
Transcription unit        Promoter
ygaM


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB