RegulonDB RegulonDB 10.8: Gene Form
   

nrdH gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

nrdE nrdI ygaM nrdH NrdR NrdR Fur terminator anti-terminator anti-anti-terminator nrdHp nrdHp ygaCp ygaCp

Gene      
Name: nrdH    Texpresso search in the literature
Synonym(s): ECK2667, G7401, b2673, ygaN
Genome position(nucleotides): 2800723 --> 2800968 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.25
External database links:  
ASAP:
ABE-0008802
ECHOBASE:
EB3071
OU-MICROARRAY:
b2673
PortEco:
nrdH
STRING:
511145.b2673
COLOMBOS: nrdH


Product      
Name: glutaredoxin-like protein
Synonym(s): NrdH, YgaN
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 9.139
Isoelectric point: 8.258
Motif(s):
 
Type Positions Sequence
1 -> 81 MRITIYTRNDCVQCHATKRAMENRGFDFEMINVDRVPEAAEALRAQGFRQLPVVIAGDLSWSGFRPDMINRLHPAPHAASA
3 -> 57 ITIYTRNDCVQCHATKRAMENRGFDFEMINVDRVPEAAEALRAQGFRQLPVVIAG

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.15 - large molecule carriers --> 1.6.15.2 - thioredoxin, glutaredoxin
Gene Ontology Terms (GO)  
cellular_component GO:0005623 - cell
GO:0005829 - cytosol
molecular_function GO:0009055 - electron transfer activity
GO:0015035 - protein disulfide oxidoreductase activity
biological_process GO:0045454 - cell redox homeostasis
GO:0022900 - electron transport chain
GO:0055114 - oxidation-reduction process
GO:0051353 - positive regulation of oxidoreductase activity
Note(s): Note(s): ...[more].
Evidence: [APPH] Assay of protein purified to homogeneity
Reference(s): [1] Jordan A., et al., 1997
External database links:  
DIP:
DIP-48164N
ECOCYC:
G7401-MONOMER
ECOLIWIKI:
b2673
INTERPRO:
IPR002109
INTERPRO:
IPR036249
INTERPRO:
IPR011909
MODBASE:
P0AC65
PDB:
1H75
PFAM:
PF00462
PRIDE:
P0AC65
PRODB:
PRO_000023408
PROSITE:
PS51354
REFSEQ:
NP_417159
SMR:
P0AC65
UNIPROT:
P0AC65


Operon      
Name: nrdHIEF         
Operon arrangement:
Transcription unit        Promoter
nrdHIEF


Transcriptional Regulation      
Display Regulation             
Activated by: IscR
Repressed by: Fur, NrdR


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Jordan A., Aslund F., Pontis E., Reichard P., Holmgren A., 1997, Characterization of Escherichia coli NrdH. A glutaredoxin-like protein with a thioredoxin-like activity profile., J Biol Chem 272(29):18044-50


RegulonDB