RegulonDB RegulonDB 10.8: Gene Form
   

yqaB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

gshA yqaB yqaA argQ TSS_3001 TSS_3001 TSS_3000 TSS_3000 TSS_2999 TSS_2999 TSS_2998 TSS_2998 luxSp1 luxSp1

Gene      
Name: yqaB    Texpresso search in the literature
Synonym(s): ECK2685, G7408, b2690
Genome position(nucleotides): 2816937 <-- 2817503 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.44
External database links:  
ASAP:
ABE-0008850
ECHOBASE:
EB3301
OU-MICROARRAY:
b2690
PortEco:
yqaB
STRING:
511145.b2690
COLOMBOS: yqaB


Product      
Name: fructose-1-phosphate phosphatase YqaB
Synonym(s): HAD6, YqaB, fructose-1-phosphatase
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 20.78
Isoelectric point: 5.766
Motif(s):
 
Type Positions Sequence
11 -> 13 DMD
8 -> 183 LIFDMDGTILDTEPTHRKAWREVLGHYGLQYDIQAMIALNGSPTWRIAQAIIELNQADLDPHALAREKTEAVRSMLLDSVEPLPLVDVVKSWHGRRPMAVGTGSESAIAEALLAHLGLRHYFDAVVAADHVKHHKPAPDTFLLCAQRMGVQPTQCVVFEDADFGIQAARAAGMDAV

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016787 - hydrolase activity
GO:0046872 - metal ion binding
GO:0008801 - beta-phosphoglucomutase activity
GO:0016791 - phosphatase activity
GO:0050308 - sugar-phosphatase activity
GO:0000287 - magnesium ion binding
biological_process GO:0016311 - dephosphorylation
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-12842N
ECOCYC:
G7408-MONOMER
ECOLIWIKI:
b2690
INTERPRO:
IPR023198
INTERPRO:
IPR041492
INTERPRO:
IPR036412
INTERPRO:
IPR023214
INTERPRO:
IPR010976
INTERPRO:
IPR006439
MINT:
MINT-1265616
MODBASE:
P77475
PFAM:
PF13419
PRIDE:
P77475
PRINTS:
PR00413
REFSEQ:
NP_417175
SMR:
P77475
UNIPROT:
P77475


Operon      
Name: yqaBA         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2998 2815236 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2999 2815242 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_3000 2816260 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_3001 2816461 reverse nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB