RegulonDB RegulonDB 10.8: Gene Form
   

pncC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

mltB recA pncC CRP LexA anti-anti-terminator anti-terminator TSS_3016 TSS_3016 pncCp pncCp recAp recAp TSS_3015 TSS_3015 TSS_3014 TSS_3014 TSS_3013 TSS_3013

Gene      
Name: pncC    Texpresso search in the literature
Synonym(s): ECK2695, G7409, b2700, ygaD
Genome position(nucleotides): 2823849 <-- 2824346 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
56.63
External database links:  
ASAP:
ABE-0008882
ECHOBASE:
EB2560
OU-MICROARRAY:
b2700
PortEco:
ygaD
STRING:
511145.b2700
COLOMBOS: pncC


Product      
Name: NMN aminohydrolase
Synonym(s): PncC, YgaD
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 17.582
Isoelectric point: 4.774
Motif(s):
 
Type Positions Sequence
8 -> 160 QLSEQVGQALKARGATVTTAESCTGGWVAKVITDIAGSSAWFERGFVTYSNEAKAQMIGVREETLAQHGAVSEPVVVEMAIGALKAARADYAVSISGIAGPDGGSEEKPVGTVWFAFATARGEGITRRECFSGDRDAVRRQATAYALQTLWQQ

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.3 - cofactors, small molecule carriers --> 1.5.3.7 - nicotinamide adenine dinucleotide
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016787 - hydrolase activity
GO:0019159 - nicotinamide-nucleotide amidase activity
biological_process GO:0019363 - pyridine nucleotide biosynthetic process
External database links:  
DIP:
DIP-48189N
ECOCYC:
G7409-MONOMER
ECOLIWIKI:
b2700
INTERPRO:
IPR008136
INTERPRO:
IPR036653
PFAM:
PF02464
PRIDE:
P0A6G3
REFSEQ:
NP_417180
SMR:
P0A6G3
UNIPROT:
P0A6G3


Operon      
Name: pncC         
Operon arrangement:
Transcription unit        Promoter
pncC


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3013 2823573 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_3014 2823575 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_3015 2823818 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_3016 2825541 reverse nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB