RegulonDB RegulonDB 10.8: Gene Form
   

mltB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

mltB srlA pncC srlE CRP CRP srlAp srlAp TSS_3016 TSS_3016 pncCp pncCp

Gene      
Name: mltB    Texpresso search in the literature
Synonym(s): ECK2696, G7410, b2701, slt
Genome position(nucleotides): 2824491 <-- 2825576 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.16
External database links:  
ASAP:
ABE-0008885
ECHOBASE:
EB2561
OU-MICROARRAY:
b2701
PortEco:
mltB
STRING:
511145.b2701
COLOMBOS: mltB


Product      
Name: membrane-bound lytic murein transglycosylase B
Synonym(s): MltB, Slt, Slt35
Sequence: Get amino acid sequence Fasta Format
Cellular location: outer membrane,periplasmic space
Molecular weight: 40.256
Isoelectric point: 9.37
Motif(s):
 
Type Positions Sequence
19 -> 39 CSSKPKPTETDTTTGTPSGGF
1 -> 18 MFKRRYVTLLPLFVLLAA
109 -> 169 GPNGAWLRYRKKFITPDNVQNGVVFWNQYEDALNRAWQVYGVPPEIIVGIIGVETRWGRVM
237 -> 251 DFSGDGHINLWDPVD
170 -> 215 GKTRILDALATLSFNYPRRAEYFSGELETFLLMARDEQDDPLNLKG

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.2 - degradation of macromolecules --> 1.2.3 - proteins/peptides/glycopeptides
Gene Ontology Terms (GO)  
cellular_component GO:0009279 - cell outer membrane
GO:0016020 - membrane
GO:0030288 - outer membrane-bounded periplasmic space
GO:0036405 - anchored component of cell outer membrane
molecular_function GO:0005515 - protein binding
GO:0016829 - lyase activity
GO:0008933 - lytic transglycosylase activity
GO:0005509 - calcium ion binding
GO:0031402 - sodium ion binding
GO:0008932 - lytic endotransglycosylase activity
biological_process GO:0009253 - peptidoglycan catabolic process
GO:0071555 - cell wall organization
Note(s): Note(s): ...[more].
Reference(s): [1] Blackburn NT., et al., 2001
[2] Brokx SJ., et al., 2004
[3] Gill RT., et al., 2001
[4] Hamdallah I., et al., 2018
[5] Heidrich C., et al., 2002
[6] Korsak D., et al., 2005
[7] Maurer LM., et al., 2005
[8] Meisel U., et al., 2003
[9] Molloy MP., et al., 2000
[10] Romeis T., et al., 1993
[11] Schiffer G., et al., 1999
[12] Van Dyk TK., et al., 2001
[13] Vijayakumar SR., et al., 2004
[14] Vollmer W., et al., 1999
External database links:  
CAZY:
GH103
DIP:
DIP-10221N
ECOCYC:
G7410-MONOMER
ECOLIWIKI:
b2701
INTERPRO:
IPR031304
INTERPRO:
IPR023346
INTERPRO:
IPR011757
MINT:
MINT-1257117
MODBASE:
P41052
PANTHER:
PTHR30163:SF0
PDB:
1qdt
PDB:
1qus
PDB:
1qut
PDB:
1qdr
PDB:
1d0m
PDB:
1d0k
PDB:
1d0l
PDB:
1ltm
PFAM:
PF13406
PRIDE:
P41052
PRODB:
PRO_000023246
PROSITE:
PS51257
REFSEQ:
NP_417181
SMR:
P41052
SWISSMODEL:
P41052
UNIPROT:
P41052


Operon      
Name: mltB         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3016 2825541 reverse nd [RS-EPT-CBR] [15]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Blackburn NT., Clarke AJ., 2001, Identification of four families of peptidoglycan lytic transglycosylases., J Mol Evol 52(1):78-84

 [2] Brokx SJ., Ellison M., Locke T., Bottorff D., Frost L., Weiner JH., 2004, Genome-wide analysis of lipoprotein expression in Escherichia coli MG1655., J Bacteriol 186(10):3254-8

 [3] Gill RT., DeLisa MP., Valdes JJ., Bentley WE., 2001, Genomic analysis of high-cell-density recombinant Escherichia coli fermentation and "cell conditioning" for improved recombinant protein yield., Biotechnol Bioeng 72(1):85-95

 [4] Hamdallah I., Torok N., Bischof KM., Majdalani N., Chadalavada S., Mdluli N., Creamer KE., Clark M., Holdener C., Basting PJ., Gottesman S., Slonczewski JL., 2018, Experimental Evolution of Escherichia coli K-12 at High pH and with RpoS Induction., Appl Environ Microbiol 84(15)

 [5] Heidrich C., Ursinus A., Berger J., Schwarz H., Holtje JV., 2002, Effects of multiple deletions of murein hydrolases on viability, septum cleavage, and sensitivity to large toxic molecules in Escherichia coli., J Bacteriol 184(22):6093-9

 [6] Korsak D., Liebscher S., Vollmer W., 2005, Susceptibility to antibiotics and beta-lactamase induction in murein hydrolase mutants of Escherichia coli., Antimicrob Agents Chemother 49(4):1404-9

 [7] Maurer LM., Yohannes E., Bondurant SS., Radmacher M., Slonczewski JL., 2005, pH regulates genes for flagellar motility, catabolism, and oxidative stress in Escherichia coli K-12., J Bacteriol 187(1):304-19

 [8] Meisel U., Holtje JV., Vollmer W., 2003, Overproduction of inactive variants of the murein synthase PBP1B causes lysis in Escherichia coli., J Bacteriol 185(18):5342-8

 [9] Molloy MP., Herbert BR., Slade MB., Rabilloud T., Nouwens AS., Williams KL., Gooley AA., 2000, Proteomic analysis of the Escherichia coli outer membrane., Eur J Biochem 267(10):2871-81

 [10] Romeis T., Vollmer W., Holtje JV., 1993, Characterization of three different lytic transglycosylases in Escherichia coli., FEMS Microbiol Lett 111(2-3):141-6

 [11] Schiffer G., Holtje JV., 1999, Cloning and characterization of PBP 1C, a third member of the multimodular class A penicillin-binding proteins of Escherichia coli., J Biol Chem 274(45):32031-9

 [12] Van Dyk TK., DeRose EJ., Gonye GE., 2001, LuxArray, a high-density, genomewide transcription analysis of Escherichia coli using bioluminescent reporter strains., J Bacteriol 183(19):5496-505

 [13] Vijayakumar SR., Kirchhof MG., Patten CL., Schellhorn HE., 2004, RpoS-regulated genes of Escherichia coli identified by random lacZ fusion mutagenesis., J Bacteriol 186(24):8499-507

 [14] Vollmer W., von Rechenberg M., Holtje JV., 1999, Demonstration of molecular interactions between the murein polymerase PBP1B, the lytic transglycosylase MltA, and the scaffolding protein MipA of Escherichia coli., J Biol Chem 274(10):6726-34

 [15] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB