RegulonDB RegulonDB 10.8: Gene Form
   

norV gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

norR norV norW C0664 gutQ IHF IHF NarP NarL NarP NarL NorR NorR NorR FNR NsrR terminator norVp norVp norRp norRp

Gene      
Name: norV    Texpresso search in the literature
Synonym(s): ECK2705, G7413, b2710, ygaI, ygaJ, ygaK
Genome position(nucleotides): 2832476 --> 2833915 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.33
External database links:  
ASAP:
ABE-0008910
ECHOBASE:
EB2793
OU-MICROARRAY:
b2710
PortEco:
norV
STRING:
511145.b2710
COLOMBOS: norV


Product      
Name: anaerobic nitric oxide reductase flavorubredoxin
Synonym(s): FlRd, NorV, YgaI, YgaJ, YgaK, flavorubredoxin
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 54.234
Isoelectric point: 4.813
Motif(s):
 
Type Positions Sequence
254 -> 393 ITIFYDTMSNNTRMMADAIAQGIAETDPRVAVKIFNVARSDKNEILTNVFRSKGVLVGTSTMNNVMMPKIAGLVEEMTGLRFRNKRASAFGSHGWSGGAVDRLSTRLQDAGFEMSLSLKAKWRPDQDALKLCREHGREIA
256 -> 388 IFYDTMSNNTRMMADAIAQGIAETDPRVAVKIFNVARSDKNEILTNVFRSKGVLVGTSTMNNVMMPKIAGLVEEMTGLRFRNKRASAFGSHGWSGGAVDRLSTRLQDAGFEMSLSLKAKWRPDQDALKLCREH
423 -> 474 GPRMQCSVCQWIYDPAKGEPMQDVAPGTPWSEVPDNFLCPECSLGKDVFEEL
30 -> 210 LRGSSYNSYLIREEKNVLIDTVDHKFSREFVQNLRNEIDLADIDYIVINHAEEDHAGALTELMAQIPDTPIYCTANAIDSINGHHHHPEWNFNVVKTGDTLDIGNGKQLIFVETPMLHWPDSMMTYLTGDAVLFSNDAFGQHYCDEHLFNDEVDQTELFEQCQRYYANILTPFSRLVTPKI
413 -> 479 ETSATTTADLGPRMQCSVCQWIYDPAKGEPMQDVAPGTPWSEVPDNFLCPECSLGKDVFEELASEAK

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.4 - energy production/transport --> 1.4.3 - electron carriers
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
GO:0032991 - protein-containing complex
molecular_function GO:0009055 - electron transfer activity
GO:0046872 - metal ion binding
GO:0016491 - oxidoreductase activity
GO:0005506 - iron ion binding
GO:0016661 - oxidoreductase activity, acting on other nitrogenous compounds as donors
GO:0010181 - FMN binding
GO:0016966 - nitric oxide reductase activity
GO:0042802 - identical protein binding
biological_process GO:0022900 - electron transport chain
GO:0055114 - oxidation-reduction process
GO:0071731 - response to nitric oxide
GO:0046210 - nitric oxide catabolic process
External database links:  
DIP:
DIP-28070N
ECOCYC:
G7413-MONOMER
ECOLIWIKI:
b2710
INTERPRO:
IPR001279
INTERPRO:
IPR036866
INTERPRO:
IPR029039
INTERPRO:
IPR024935
INTERPRO:
IPR024934
INTERPRO:
IPR023957
INTERPRO:
IPR016440
INTERPRO:
IPR008254
MODBASE:
Q46877
PDB:
5LMC
PDB:
2MS3
PDB:
4D02
PDB:
5LLD
PDB:
6ETB
PFAM:
PF00258
PFAM:
PF00753
PFAM:
PF00301
PRIDE:
Q46877
PRINTS:
PR00163
PRODB:
PRO_000023399
PROSITE:
PS50902
PROSITE:
PS50903
REFSEQ:
NP_417190
SMART:
SM00849
SMR:
Q46877
SWISSMODEL:
Q46877
UNIPROT:
Q46877


Operon      
Name: norVW         
Operon arrangement:
Transcription unit        Promoter
norVW


Transcriptional Regulation      
Display Regulation             
Activated by: IHF, NorR
Repressed by: FNR, IHF, NarL, NarP


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB