RegulonDB RegulonDB 10.7: Gene Form
   

hycI gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ascB hycG hycI hycH hycIp4 hycIp4 TSS_3021 TSS_3021

Gene      
Name: hycI    Texpresso search in the literature
Synonym(s): ECK2712, G7414, b2717
Genome position(nucleotides): 2842573 <-- 2843043 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.93
External database links:  
ASAP:
ABE-0008931
ECHOBASE:
EB3177
OU-MICROARRAY:
b2717
PORTECO:
hycI
REGULONDB:
b2717
STRING:
511145.b2717
M3D: hycI
COLOMBOS: hycI
PortEco: b2717


Product      
Name: hydrogenase 3 maturation protease
Synonym(s): HycE processing protein, HycI
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 17.057
Isoelectric point: 3.795
Motif(s):
 
Type Positions Sequence
16 -> 16 D
90 -> 90 H
23 -> 140 AEKCAAAPKGNWVVIDGGSAPENDIVAIRELRPTRLLIVDATDMGLNPGEIRIIDPDDIAEMFMMTTHNMPLNYLIDQLKEDIGEVIFLGIQPDIVGFYYPMTQPIKDAVETVYQRLE
2 -> 156 TDVLLCVGNSMMGDDGAGPLLAEKCAAAPKGNWVVIDGGSAPENDIVAIRELRPTRLLIVDATDMGLNPGEIRIIDPDDIAEMFMMTTHNMPLNYLIDQLKEDIGEVIFLGIQPDIVGFYYPMTQPIKDAVETVYQRLEGWEGNGGFAQLAVEEE
62 -> 62 D

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.3 - protein related --> 2.3.3 - posttranslational modification
  2 - information transfer --> 2.3 - protein related --> 2.3.4 - chaperoning, repair (refolding)
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
GO:0008047 - enzyme activator activity
GO:0008233 - peptidase activity
GO:0016787 - hydrolase activity
GO:0046872 - metal ion binding
GO:0004175 - endopeptidase activity
GO:0004190 - aspartic-type endopeptidase activity
biological_process GO:0006464 - cellular protein modification process
GO:0006508 - proteolysis
GO:0016485 - protein processing
GO:0043085 - positive regulation of catalytic activity
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-48019N
ECOCYC:
G7414-MONOMER
ECOLIWIKI:
b2717
INTERPRO:
IPR004420
INTERPRO:
IPR023430
INTERPRO:
IPR000671
MINT:
MINT-1244231
PANTHER:
PTHR30302
PDB:
2I8L
PDB:
2E85
PFAM:
PF01750
PRIDE:
P0AEV9
PRINTS:
PR00446
PRODB:
PRO_000022961
PROTEINMODELPORTAL:
P0AEV9
REFSEQ:
NP_417197
SMR:
P0AEV9
UNIPROT:
P0AEV9


Operon      
Name: hycABCDEFGHI         
Operon arrangement:
Transcription unit        Promoter
hycABCDEFGHI


Transcriptional Regulation      
Display Regulation             
Activated by: FhlA, IHF, ModE
Repressed by: NsrR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3021 2843079 reverse nd [RS-EPT-CBR] [1]
  promoter hycIp4 2843102 reverse Similarity to the consensus
Read more >
[ICWHO], [RS-EPT-CBR] [1], [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB