RegulonDB RegulonDB 10.7: Gene Form
   

pphB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

mutS ygbI pphB terminator pphBp1 pphBp1

Gene      
Name: pphB    Texpresso search in the literature
Synonym(s): ECK2729, G7415, b2734, prpB, ygbH
Genome position(nucleotides): 2859760 --> 2860416 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
42.31
External database links:  
ASAP:
ABE-0008980
ECHOBASE:
EB2905
OU-MICROARRAY:
b2734
PORTECO:
pphB
REGULONDB:
b2734
STRING:
511145.b2734
M3D: pphB
COLOMBOS: pphB
PortEco: b2734


Product      
Name: phosphoprotein phosphatase 2
Synonym(s): PphB, PrpB, YgbH
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 25.098
Isoelectric point: 5.054
Motif(s):
 
Type Positions Sequence
16 -> 188 HIWVVGDIHGEYQLLQSRLHQLSFFPKIDLLISVGDNIDRGPESLDVLRLLNQPWFTSVKGNHEAMALEAFETGDGNMWLASGGDWFFDLNDSEQQEAIDLLLKFHHLPHIIEITNDNIKYAIAHADYPGSEYLFGKEIAESELLWPVDRVQKSLNGELQQINGADYFIFGHM
78 -> 78 H

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.3 - protein related --> 2.3.3 - posttranslational modification
  3 - regulation --> 3.1 - type of regulation --> 3.1.3 - posttranscriptional --> 3.1.3.2 - covalent modification, demodification, maturation
  3 - regulation --> 3.1 - type of regulation --> 3.1.3 - posttranscriptional --> 3.1.3.3 - inhibition / activation of enzymes
  5 - cell processes --> 5.5 - adaptations --> 5.5.6 - other (mechanical, nutritional, oxidative stress)
Gene Ontology Terms (GO)  
molecular_function GO:0016787 - hydrolase activity
GO:0046872 - metal ion binding
GO:0004721 - phosphoprotein phosphatase activity
GO:0008138 - protein tyrosine/serine/threonine phosphatase activity
biological_process GO:0006470 - protein dephosphorylation
Note(s): Note(s): ...[more].
Reference(s): [1] Li B., et al., 2005
External database links:  
ECOCYC:
G7415-MONOMER
ECOLIWIKI:
b2734
INTERPRO:
IPR004843
INTERPRO:
IPR006186
INTERPRO:
IPR029052
MODBASE:
P55799
PFAM:
PF00149
PRIDE:
P55799
PRODB:
PRO_000023578
PROSITE:
PS00125
PROTEINMODELPORTAL:
P55799
REFSEQ:
NP_417214
SMR:
P55799
SWISSMODEL:
P55799
UNIPROT:
P55799


Operon      
Name: pphB         
Operon arrangement:
Transcription unit        Promoter
 


RNA cis-regulatory element    
Attenuation: Translational


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter pphBp1 2859737 forward Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Li B., Brown EW., D'Agostino C., Leclerc JE., Cebula TA., 2005, Structure and distribution of the phosphoprotein phosphatase genes, prpA and prpB, among Shigella subgroups., Microbiology 151(Pt 8):2671-83

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB