RegulonDB RegulonDB 10.7: Gene Form
   

ygbL gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ygbK ygbM ygbL ygbJ ygbNp2 ygbNp2 ygbLp4 ygbLp4 ygbLp5 ygbLp5

Gene      
Name: ygbL    Texpresso search in the literature
Synonym(s): ECK2733, G7419, b2738
Genome position(nucleotides): 2863593 --> 2864231 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.52
External database links:  
ASAP:
ABE-0008994
ECHOBASE:
EB2909
OU-MICROARRAY:
b2738
PORTECO:
ygbL
REGULONDB:
b2738
STRING:
511145.b2738
M3D: ygbL
COLOMBOS: ygbL
PortEco: b2738


Product      
Name: putative 3-oxo-tetronate 4-phosphate decarboxylase YgbL
Synonym(s): YgbL, putative class II aldolase
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 23.222
Isoelectric point: 5.677
Motif(s):
 
Type Positions Sequence
14 -> 190 EMTRIASSFFQRGYATGSAGNLSLLLPDGNLLATPTGSCLGNLDPQRLSKVAADGEWLSGDKPSKEVLFHLALYRNNPRCKAVVHLHSTWSTALSCLQGLDSSNVIRPFTPYVVMRMGNVPLVPYYRPGDKRIAQDLAELAADNQAFLLANHGPVVCGESLQEAANNMEELEETAKL

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.1 - unassigned reversible reactions
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016829 - lyase activity
GO:0046872 - metal ion binding
GO:0016832 - aldehyde-lyase activity
biological_process GO:0005975 - carbohydrate metabolic process
GO:0019323 - pentose catabolic process
Note(s): Note(s): ...[more].
Reference(s): [1] Zhang X., et al., 2016
External database links:  
DIP:
DIP-12113N
ECOCYC:
G7419-MONOMER
ECOLIWIKI:
b2738
INTERPRO:
IPR001303
INTERPRO:
IPR036409
MODBASE:
Q46890
PFAM:
PF00596
PRIDE:
Q46890
PROTEINMODELPORTAL:
Q46890
REFSEQ:
NP_417218
SMART:
SM01007
SMR:
Q46890
UNIPROT:
Q46890


Operon      
Name: ygbLM         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ygbLp5 2863537 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter ygbLp4 2863569 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter ygbNp2 2864907 forward Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Zhang X., Carter MS., Vetting MW., San Francisco B., Zhao S., Al-Obaidi NF., Solbiati JO., Thiaville JJ., de Crecy-Lagard V., Jacobson MP., Almo SC., Gerlt JA., 2016, Assignment of function to a domain of unknown function: DUF1537 is a new kinase family in catabolic pathways for acid sugars., Proc Natl Acad Sci U S A 113(29):E4161-9

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB