RegulonDB RegulonDB 10.7: Gene Form
   

ygbM gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ygbN ygbM ygbL ygbNp2 ygbNp2

Gene      
Name: ygbM    Texpresso search in the literature
Synonym(s): ECK2734, G7420, b2739
Genome position(nucleotides): 2864236 --> 2865012 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.48
External database links:  
ASAP:
ABE-0008996
ECHOBASE:
EB2910
OU-MICROARRAY:
b2739
PORTECO:
ygbM
REGULONDB:
b2739
STRING:
511145.b2739
M3D: ygbM
COLOMBOS: ygbM
PortEco: b2739


Product      
Name: putative 2-oxo-tetronate isomerase YgbM
Synonym(s): YgbM
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 29.217
Isoelectric point: 4.902
Motif(s):
 
Type Positions Sequence
21 -> 219 FAAARKAGFDAVEFLFPYNYSTLQIQKQLEQNHLTLALFNTAPGDINAGEWGLSALPGREHEAHADIDLALEYALALNCEQVHVMAGVVPAGEDAERYRAVFIDNIRYAADRFAPHGKRILVEALSPGVKPHYLFSSQYQALAIVEEVARDNVFIQLDTFHAQKVDGNLTHLIRDYAGKYAHVQIAGLPDRHEPDDGEI

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016853 - isomerase activity
GO:0046872 - metal ion binding
GO:0008903 - hydroxypyruvate isomerase activity
biological_process GO:0005975 - carbohydrate metabolic process
GO:0046487 - glyoxylate metabolic process
Note(s): Note(s): ...[more].
Reference(s): [1] Zhang X., et al., 2016
External database links:  
DIP:
DIP-12114N
ECOCYC:
G7420-MONOMER
ECOLIWIKI:
b2739
INTERPRO:
IPR013022
INTERPRO:
IPR036237
INTERPRO:
IPR026040
MINT:
MINT-1286505
MODBASE:
Q46891
PDB:
1K77
PFAM:
PF01261
PRIDE:
Q46891
PROTEINMODELPORTAL:
Q46891
REFSEQ:
NP_417219
SMR:
Q46891
UNIPROT:
Q46891


Operon      
Name: ygbLM         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ygbNp2 2864907 forward Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Zhang X., Carter MS., Vetting MW., San Francisco B., Zhao S., Al-Obaidi NF., Solbiati JO., Thiaville JJ., de Crecy-Lagard V., Jacobson MP., Almo SC., Gerlt JA., 2016, Assignment of function to a domain of unknown function: DUF1537 is a new kinase family in catabolic pathways for acid sugars., Proc Natl Acad Sci U S A 113(29):E4161-9

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB