RegulonDB RegulonDB 10.7: Gene Form
   

truD gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

truD umpG ispD pcm ispF ispFp3 ispFp3 ispFp2 ispFp2 surEp2 surEp2

Gene      
Name: truD    Texpresso search in the literature
Synonym(s): ECK2740, G7422, b2745, ygbO
Genome position(nucleotides): 2870255 <-- 2871304 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.19
External database links:  
ASAP:
ABE-0009011
ECHOBASE:
EB2912
OU-MICROARRAY:
b2745
PORTECO:
truD
REGULONDB:
b2745
STRING:
511145.b2745
M3D: truD
COLOMBOS: truD
PortEco: b2745


Product      
Name: tRNA pseudouridine13 synthase
Synonym(s): TruD, YgbO
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 39.091
Isoelectric point: 6.532
Motif(s):
 
Type Positions Sequence
8 -> 167 TYLHGKPQGTGLLKANPEDFVVVEDLGFEPDGEGEHILVRILKNGCNTRFVADALAKFLKIHAREVSFAGQKDKHAVTEQWLCARVPGKEMPDLSAFQLEGCQVLEYARHKRKLRLGALKGNAFTLVLREVSNRDDVEQRLIDICVKGVPNYFGAQRFGI
180 -> 187 QTNTPVRD
188 -> 337 RNKRSFWLSAARSALFNQIVAERLKKADVNQVVDGDALQLAGRGSWFVATTEELAELQRRVNDKELMITAALPGSGEWGTQREALAFEQAAVAAETELQALLVREKVEAARRAMLLYPQQLSWNWWDDVTVEIRFWLPAGSFATSVVREL
87 -> 87 Q
80 -> 80 D

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.3 - RNA modification
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0106029 - tRNA pseudouridine synthase activity
GO:0016853 - isomerase activity
GO:0003723 - RNA binding
GO:0009982 - pseudouridine synthase activity
biological_process GO:0009451 - RNA modification
GO:0001522 - pseudouridine synthesis
GO:0031119 - tRNA pseudouridine synthesis
GO:0008033 - tRNA processing
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G7422-MONOMER
ECOLIWIKI:
b2745
INTERPRO:
IPR020119
INTERPRO:
IPR020103
INTERPRO:
IPR011760
INTERPRO:
IPR042214
INTERPRO:
IPR001656
MODBASE:
Q57261
PANTHER:
PTHR13326
PDB:
1SZW
PDB:
1SI7
PDB:
1SB7
PFAM:
PF01142
PRIDE:
Q57261
PRODB:
PRO_000024128
PROSITE:
PS01268
PROSITE:
PS50984
PROTEINMODELPORTAL:
Q57261
REFSEQ:
NP_417225
SMR:
Q57261
UNIPROT:
Q57261


Operon      
Name: truD         
Operon arrangement:
Transcription unit        Promoter
truD


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ispFp2 2871911 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter ispFp3 2871984 reverse Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB