RegulonDB RegulonDB 10.7: Gene Form
   

ftsB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ispD ygbE ftsB TSS_3038 TSS_3038 TSS_3037 TSS_3037 ftsBp ftsBp TSS_3036 TSS_3036 ispFp3 ispFp3 ispFp2 ispFp2

Gene      
Name: ftsB    Texpresso search in the literature
Synonym(s): ECK2743, G7424, b2748, ygbQ
Genome position(nucleotides): 2872509 <-- 2872820 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.92
External database links:  
ASAP:
ABE-0009019
ECHOBASE:
EB2914
OU-MICROARRAY:
b2748
PORTECO:
ftsB
REGULONDB:
b2748
STRING:
511145.b2748
M3D: ftsB
COLOMBOS: ftsB
PortEco: b2748


Product      
Name: cell division protein FtsB
Synonym(s): FtsB, YgbQ, essential cell division protein FtsB
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 11.622
Isoelectric point: 7.527
Motif(s):
 
Type Positions Sequence
4 -> 21 LTLLLLAILVWLQYSLWF
41 -> 72 ATNAKLKARNDQLFAEIDDLNGGQEALEERAR
11 -> 89 ILVWLQYSLWFGKNGIHDYTRVNDDVAAQQATNAKLKARNDQLFAEIDDLNGGQEALEERARNELSMTRPGETFYRLVP

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.1 - cell division
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
GO:0032153 - cell division site
GO:0030428 - cell septum
molecular_function GO:0005515 - protein binding
GO:0042802 - identical protein binding
biological_process GO:0051301 - cell division
GO:0007049 - cell cycle
GO:0043093 - FtsZ-dependent cytokinesis
Note(s): Note(s): ...[more].
Evidence: [IMP] Inferred from mutant phenotype
Reference(s): [1] Buddelmeijer N., et al., 2002
[2] Khadria AS., et al., 2013
External database links:  
DIP:
DIP-12117N
ECOCYC:
G7424-MONOMER
ECOLIWIKI:
b2748
INTERPRO:
IPR007060
INTERPRO:
IPR023081
PANTHER:
PTHR37485
PDB:
4IFF
PDB:
5Z2W
PFAM:
PF04977
PRIDE:
P0A6S5
PRODB:
PRO_000022715
PROTEINMODELPORTAL:
P0A6S5
REFSEQ:
NP_417228
SMR:
P0A6S5
UNIPROT:
P0A6S5


Operon      
Name: ftsB         
Operon arrangement:
Transcription unit        Promoter
ftsB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ispFp2 2871911 reverse Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter ispFp3 2871984 reverse Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter TSS_3036 2872900 reverse nd [RS-EPT-CBR] [4]
  promoter ftsBp 2872901 reverse nd [AIPP] [5]
  promoter TSS_3037 2872957 reverse nd [RS-EPT-CBR] [4]
  promoter TSS_3038 2872975 reverse nd [RS-EPT-CBR] [4]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [AIPP] Automated inference of promoter position



Reference(s)    

 [1] Buddelmeijer N., Judson N., Boyd D., Mekalanos JJ., Beckwith J., 2002, YgbQ, a cell division protein in Escherichia coli and Vibrio cholerae, localizes in codependent fashion with FtsL to the division site., Proc Natl Acad Sci U S A 99(9):6316-21

 [2] Khadria AS., Senes A., 2013, The transmembrane domains of the bacterial cell division proteins FtsB and FtsL form a stable high-order oligomer., Biochemistry 52(43):7542-50

 [3] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [4] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [5] Gama-Castro S., Jimenez-Jacinto V., Peralta-Gil M., Santos-Zavaleta A., Penaloza-Spinola MI., Contreras-Moreira B., Segura-Salazar J., Muniz-Rascado L., Martinez-Flores I., Salgado H., Bonavides-Martinez C., Abreu-Goodger C., Rodriguez-Penagos C., Miranda-Rios J., Morett E., Merino E., Huerta AM., Trevino-Quintanilla L., Collado-Vides J., 2008, RegulonDB (version 6.0): gene regulation model of Escherichia coli K-12 beyond transcription, active (experimental) annotated promoters and Textpresso navigation., Nucleic Acids Res 36(Database issue):D120-4


RegulonDB