RegulonDB RegulonDB 10.8: Gene Form
   

cas1 gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

cas1 casE cas2 casD ygbFp ygbFp

Gene      
Name: cas1    Texpresso search in the literature
Synonym(s): ECK2750, G7425, b2755, ygbT
Genome position(nucleotides): 2878855 <-- 2879772 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.31
External database links:  
ASAP:
ABE-0009038
ECHOBASE:
EB2915
OU-MICROARRAY:
b2755
PortEco:
cas1
STRING:
511145.b2755
COLOMBOS: cas1


Product      
Name: multifunctional nuclease Cas1
Synonym(s): Cas1, YgbT
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 33.194
Isoelectric point: 8.843
Motif(s):
 
Type Positions Sequence
130 -> 228 ARRSVEQLRGIEGSRVRATYALLAKQYGVTWNGRRYDPKDWEKGDTINQCISAATSCLYGVTEAAILAAGYAPAIGFVHTGKPLSFVYDIADIIKFDTV
149 -> 149 Y
165 -> 165 Y
208 -> 208 H
66 -> 66 R

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.1 - DNA related --> 2.1.4 - DNA repair
  5 - cell processes --> 5.10 - defense/survival
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
molecular_function GO:0003676 - nucleic acid binding
GO:0003677 - DNA binding
GO:0004518 - nuclease activity
GO:0004519 - endonuclease activity
GO:0005515 - protein binding
GO:0016787 - hydrolase activity
GO:0046872 - metal ion binding
GO:0004520 - endodeoxyribonuclease activity
GO:0008821 - crossover junction endodeoxyribonuclease activity
GO:0042802 - identical protein binding
GO:0042803 - protein homodimerization activity
GO:0017108 - 5'-flap endonuclease activity
biological_process GO:0006281 - DNA repair
GO:0006974 - cellular response to DNA damage stimulus
GO:0051607 - defense response to virus
GO:0090305 - nucleic acid phosphodiester bond hydrolysis
GO:0043571 - maintenance of CRISPR repeat elements
External database links:  
DIP:
DIP-12118N
ECOCYC:
G7425-MONOMER
ECOLIWIKI:
b2755
INTERPRO:
IPR042211
INTERPRO:
IPR042206
INTERPRO:
IPR033641
INTERPRO:
IPR019851
INTERPRO:
IPR002729
PDB:
5DQU
PDB:
3NKE
PDB:
5DS4
PDB:
5DS5
PDB:
5DS6
PDB:
5VVJ
PDB:
5VVK
PDB:
5VVL
PDB:
5WFE
PDB:
3NKD
PDB:
5DQZ
PDB:
5DQT
PDB:
5DLJ
PDB:
4QDL
PDB:
4P6I
PFAM:
PF01867
PRIDE:
Q46896
REFSEQ:
NP_417235
SMR:
Q46896
UNIPROT:
Q46896


Operon      
Name: casABCDE12         
Operon arrangement:
Transcription unit        Promoter
ygbF
casABCDE12
casDE-ygbTF


Transcriptional Regulation      
Display Regulation             
Activated by: LeuO, SlyA
Repressed by: CRP, H-NS


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB