RegulonDB RegulonDB 10.8: Gene Form
   

casE gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

casC cas1 casD casE ygbFp ygbFp

Gene      
Name: casE    Texpresso search in the literature
Synonym(s): ECK2751, G7426, b2756, cas6e, cse3, ygcH
Genome position(nucleotides): 2879788 <-- 2880387 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
45.33
External database links:  
ASAP:
ABE-0009042
ECHOBASE:
EB2916
OU-MICROARRAY:
b2756
PortEco:
casE
STRING:
511145.b2756
COLOMBOS: casE


Product      
Name: pre-CRISPR RNA endonuclease
Synonym(s): Cas6e, CasE, YgcH, crRNA endonuclease
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 22.293
Isoelectric point: 10.087
Motif(s):
 
Type Positions Sequence
1 -> 198 MYLSKVIIARAWSRDLYQLHQGLWHLFPNRPDAARDFLFHVEKRNTPEGCHVLLQSAQMPVSTAVATVIKTKQVEFQLQVGVPLYFRLRANPIKTILDNQKRLDSKGNIKRCRVPLIKEAEQIAWLQRKLGNAARVEDVHPISERPQYFSGDGKSGKIQTVCFEGVLTINDAPALIDLVQQGIGPAKSMGCGLLSLAP
20 -> 20 H
2 -> 199 YLSKVIIARAWSRDLYQLHQGLWHLFPNRPDAARDFLFHVEKRNTPEGCHVLLQSAQMPVSTAVATVIKTKQVEFQLQVGVPLYFRLRANPIKTILDNQKRLDSKGNIKRCRVPLIKEAEQIAWLQRKLGNAARVEDVHPISERPQYFSGDGKSGKIQTVCFEGVLTINDAPALIDLVQQGIGPAKSMGCGLLSLAPL

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.10 - defense/survival
Gene Ontology Terms (GO)  
cellular_component GO:0032991 - protein-containing complex
molecular_function GO:0004518 - nuclease activity
GO:0004519 - endonuclease activity
GO:0005515 - protein binding
GO:0016787 - hydrolase activity
GO:0003723 - RNA binding
GO:0004521 - endoribonuclease activity
biological_process GO:0006396 - RNA processing
GO:0051607 - defense response to virus
GO:0090502 - RNA phosphodiester bond hydrolysis, endonucleolytic
Note(s): Note(s): ...[more].
Reference(s): [1] Datsenko KA., et al., 2012
[2] Semenova E., et al., 2015
[3] van Duijn E., et al., 2012
External database links:  
DIP:
DIP-12124N
ECOCYC:
G7426-MONOMER
ECOLIWIKI:
b2756
INTERPRO:
IPR010179
PDB:
5H9E
PDB:
5H9F
PDB:
5CD4
PDB:
4U7U
PDB:
4QYZ
PDB:
4DZD
PDB:
4TVX
PFAM:
PF08798
PRIDE:
Q46897
REFSEQ:
NP_417236
SMART:
SM01101
SMR:
Q46897
UNIPROT:
Q46897


Operon      
Name: casABCDE12         
Operon arrangement:
Transcription unit        Promoter
ygbF
casABCDE12
casDE-ygbTF


Transcriptional Regulation      
Display Regulation             
Activated by: SlyA, LeuO
Repressed by: CRP, H-NS


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Datsenko KA., Pougach K., Tikhonov A., Wanner BL., Severinov K., Semenova E., 2012, Molecular memory of prior infections activates the CRISPR/Cas adaptive bacterial immunity system., Nat Commun 3:945

 [2] Semenova E., Kuznedelov K., Datsenko KA., Boudry PM., Savitskaya EE., Medvedeva S., Beloglazova N., Logacheva M., Yakunin AF., Severinov K., 2015, The Cas6e ribonuclease is not required for interference and adaptation by the E. coli type I-E CRISPR-Cas system., Nucleic Acids Res 43(12):6049-61

 [3] van Duijn E., Barbu IM., Barendregt A., Jore MM., Wiedenheft B., Lundgren M., Westra ER., Brouns SJ., Doudna JA., van der Oost J., Heck AJ., 2012, Native tandem and ion mobility mass spectrometry highlight structural and modular similarities in clustered-regularly-interspaced shot-palindromic-repeats (CRISPR)-associated protein complexes from Escherichia coli and Pseudomonas aeruginosa., Mol Cell Proteomics 11(11):1430-41


RegulonDB