RegulonDB RegulonDB 10.8: Gene Form
   

casC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

casC casD casB casE casA

Gene      
Name: casC    Texpresso search in the literature
Synonym(s): ECK2753, G7428, b2758, cas7, cse4, ygcJ
Genome position(nucleotides): 2881051 <-- 2882142 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
43.5
External database links:  
ASAP:
ABE-0009046
ECHOBASE:
EB2918
OU-MICROARRAY:
b2758
PortEco:
casC
STRING:
511145.b2758
COLOMBOS: casC


Product      
Name: type I-E CRISPR system Cascade subunit CasC
Synonym(s): Cas7, CasC, Cascade subunit C, YgcJ
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 40.025
Isoelectric point: 6.326
Motif(s):
 
Type Positions Sequence
5 -> 352 INIHVLISHSPSCLNRDDMNMQKDAIFGGKRRVRISSQSLKRAMRKSGYYAQNIGESSLRTIHLAQLRDVLRQKLGERFDQKIIDKTLALLSGKSVDEAEKISADAVTPWVVGEIAWFCEQVAKAEADNLDDKKLLKVLKEDIAAIRVNLQQGVDIALSGRMATSGMMTELGKVDGAMSIAHAITTHQVDSDIDWFTAVDDLQEQGSAHLGTQEFSSGVFYRYANINLAQLQENLGGASREQALEIATHVVHMLATEVPGAKQRTYAAFNPADMVMVNFSDMPLSMANAFEKAVKAKDGFLQPSIQAFNQYWDRVANGYGLNGAAAQFSLSDVDPITAQVKQMPTLEQ
2 -> 58 SNFINIHVLISHSPSCLNRDDMNMQKDAIFGGKRRVRISSQSLKRAMRKSGYYAQNI
59 -> 180 GESSLRTIHLAQLRDVLRQKLGERFDQKIIDKTLALLSGKSVDEAEKISADAVTPWVVGEIAWFCEQVAKAEADNLDDKKLLKVLKEDIAAIRVNLQQGVDIALSGRMATSGMMTELGKVDG
181 -> 189 AMSIAHAIT
224 -> 263 FYRYANINLAQLQENLGGASREQALEIATHVVHMLATEVP

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.10 - defense/survival
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0032991 - protein-containing complex
molecular_function GO:0005515 - protein binding
GO:0003723 - RNA binding
GO:0071667 - DNA/RNA hybrid binding
biological_process GO:0051607 - defense response to virus
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-12126N
ECOCYC:
G7428-MONOMER
ECOLIWIKI:
b2758
INTERPRO:
IPR010148
PDB:
5H9F
PDB:
5H9E
PDB:
4U7U
PDB:
4TVX
PDB:
4QYZ
PDB:
5CD4
PFAM:
PF09344
PRIDE:
Q46899
REFSEQ:
NP_417238
SMR:
Q46899
UNIPROT:
Q46899


Operon      
Name: casABCDE12         
Operon arrangement:
Transcription unit        Promoter
ygbF
casABCDE12
casDE-ygbTF


Transcriptional Regulation      
Display Regulation             
Activated by: LeuO, SlyA
Repressed by: CRP, H-NS


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB